(data stored in ACNUC5340 zone)

EMBL: CP000828.PE263

CP000828.PE263       Location/Qualifiers
FT   CDS_pept        complement(267124..268284)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0268"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25354"
FT                   /db_xref="GOA:B0C8W4"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B0C8W4"
FT                   /protein_id="ABW25354.1"
FT                   /translation="MQVDQPITLSNGSFGLEKLPDRRQSFSTIDLNQHCQDFLDLIIDY
FT                   LSLPIAWILRRGLGHQLKIGMEVDGCVPQDILTAAHNRTSLKDLLASPNLFSQFALVST
FT                   QPGLQHWVYQDWQVYSSCLCQHQGQYLLFVSQSPLTTSERQWIERQILLMSDYFDLHLA
FT                   FNQQRAALLAKQQHLHQTTHQLGTPLSLITLYADMLQVKTTPQNGQNYLVPLQQAVKQL
FT                   HHHLQDLVDDEEEDSPLVEPCNLHDLVAENIRALQPHLQSQGMEICYPQTSEVVWIDRW
FT                   QMLQVFDNLLSNALHFSPQGGQITLTWQRFQTEILIEVRDQGPGLSSEDLCCMFSPYYS
FT                   RRQGGRGLGLAIAQQIVCRHRGRLWASNLPEGGAQFSISLPQESNN"
     atgcaggttg atcaacccat aactctaagc aatgggtctt ttggtctgga aaagcttcca        60
     gaccgtcgcc aatccttctc aaccatcgat ttaaatcagc attgccagga ttttttagat       120
     ttaattattg attatttatc cctccccatc gcttggattt tacggcgggg gttggggcat       180
     cagctaaaga ttgggatgga ggtagatggt tgtgtaccgc aggatatact cacggctgct       240
     cacaaccgca cttctctcaa ggatctccta gcatccccga atctattttc tcaatttgct       300
     cttgtatcta ctcaacccgg tttacaacac tgggtttatc aagactggca agtctacagt       360
     agctgccttt gtcagcatca ggggcagtac cttttatttg tctcccagtc tccgttaacg       420
     acgtcggaac ggcaatggat agaacgacaa attctgttaa tgagtgacta ttttgatctg       480
     catttggcct ttaatcaaca gcgagccgcg ctcttagcta aacaacagca tcttcaccag       540
     accactcatc aattggggac gccattgtca ctcatcaccc tttatgctga catgttgcaa       600
     gttaaaacaa ccccccaaaa cggtcagaac tatctagtac cgttgcaaca ggccgttaaa       660
     caactccatc atcatctcca ggatttggtg gatgacgaag aggaggactc cccccttgtt       720
     gaaccatgta atttacatga tttggtggcg gagaatatcc gcgctcttca accccacctg       780
     caaagtcagg gcatggagat ttgctatcca caaacgtctg aggtcgtttg gatagatcgt       840
     tggcaaatgc tgcaagtttt cgacaatcta ctgagtaatg ctctgcattt tagcccccaa       900
     ggaggtcaga ttacgctcac ttggcagcga ttccaaaccg aaatcttgat cgaggtcagg       960
     gatcaaggac cgggattatc atcggaagat ttgtgctgca tgttttcccc ttattactca      1020
     cgacggcaag gagggcgagg tttaggatta gcgatcgcac agcaaatcgt ttgtcgtcat      1080
     cggggtcggc tgtgggcatc taatttgcca gaaggcggtg ctcaattttc aattagtttg      1140
     ccacaagagt ccaacaatta g                                                1161
//

If you have problems or comments...

PBIL Back to PBIL home page