(data stored in ACNUC8465 zone)

EMBL: CP000828.PE268

CP000828.PE268       Location/Qualifiers
FT   CDS_pept        272031..272513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0273"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25359"
FT                   /db_xref="GOA:B0C8W9"
FT                   /db_xref="InterPro:IPR010667"
FT                   /db_xref="InterPro:IPR011747"
FT                   /db_xref="UniProtKB/TrEMBL:B0C8W9"
FT                   /protein_id="ABW25359.1"
FT                   /translation="MVQYLANSKFYFEIDGVTSLTLKSISGPEIELEVAGGDSAIGVTK
FT                   DAKTQTQATIGGVKYNSTIALTYVAGNEGEQKKLSDWYDDCHPDTFSGGGSKAMEGRKT
FT                   GSLVIYNPDGKEAMRFNFTDLFPGAKKQVGSLSVDSGGQLAEDNIDLYFTQVIRKV"
     atggttcagt atctagccaa ttccaagttt tattttgaga tagatggagt cacttcttta        60
     acccttaaat caatcagtgg ccctgaaatt gaactggaag tggcaggggg ggattcagcc       120
     attggcgtga ccaaagatgc taaaacccag actcaagcga cgattggtgg tgtcaaatac       180
     aatagcacca tcgccctcac ctatgttgca ggtaacgagg gagagcaaaa gaagctttca       240
     gattggtacg atgactgcca cccagacaca ttttcaggag gaggttcaaa agccatggaa       300
     ggccgtaaaa ccgggtcttt agtgatttat aacccggatg gcaaagaagc catgcgcttt       360
     aacttcacgg atctattccc tggggcgaaa aagcaggtgg gtagtctatc agtggatagt       420
     ggtggacaac tagcggaaga caatattgat ctgtatttca ctcaggtcat ccgcaaagtc       480
     taa                                                                     483
//

If you have problems or comments...

PBIL Back to PBIL home page