(data stored in ACNUC27125 zone)

EMBL: CP000828.PE270

CP000828.PE270       Location/Qualifiers
FT   CDS_pept        273045..273464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0275"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25361"
FT                   /db_xref="UniProtKB/TrEMBL:B0C8X1"
FT                   /protein_id="ABW25361.1"
FT                   /translation="MQLSNNLGLAPPPEAPQPITEPQTILGSVQTEFEFELPKGYLDTA
FT                   GNLHRKGIMRLSRAMDEIVPMRDPRVKANPAYATVIILSRVITRLGALDSISPNIIEGL
FT                   FACDLSYLQKFYRLINELEDGAEAEAPSSPEPQGS"
     atgcaactga gtaataattt agggctagca cctccccctg aggctcctca acctataaca        60
     gagcctcaaa caattttagg ttcggtgcaa acagagtttg aatttgagtt gcccaaaggc       120
     tacctcgata cggcagggaa tttacatcga aagggaatta tgcgcttatc cagggccatg       180
     gatgagattg tgcccatgcg cgatccacgg gtaaaagcca atccagccta tgctacggtc       240
     attattctgt ctcgggtgat cactcgtttg ggggccctag actcaatcag ccccaatatt       300
     atcgaaggtc tgtttgcctg tgacctcagc tatcttcaga agttctatcg actcatcaat       360
     gaacttgaag atggcgcaga agctgaagca ccttcgtctc ctgaacccca aggatcctaa       420
//

If you have problems or comments...

PBIL Back to PBIL home page