(data stored in ACNUC5340 zone)

EMBL: CP000828.PE271

CP000828.PE271       Location/Qualifiers
FT   CDS_pept        273506..273817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0276"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25362"
FT                   /db_xref="UniProtKB/TrEMBL:B0C8X2"
FT                   /protein_id="ABW25362.1"
FT                   /translation="MFTLPKGLLDDQGTLHRQGGLRLATGHDEIKSQRDPRVQDNPHYG
FT                   ALVLLTQAITFLGHFQTVTPLHLEQLFLTDFLYLQEVYVDLTHSYGGPIELGEHWATP"
     gtgtttactt tgcccaaagg gttactggat gatcaaggaa ccctccatcg tcaaggaggg        60
     ctacgtctgg ccacggggca tgatgagatc aaaagtcagc gagatccacg agttcaagac       120
     aatccccact atggggcttt ggttctgcta acccaggcca ttactttttt aggacacttt       180
     cagaccgtta ccccccttca tttagagcaa ttatttctaa cggactttct ttacctgcaa       240
     gaggtttacg tcgatctcac ccattcttac ggaggcccga ttgaactggg ggagcactgg       300
     gctaccccct ag                                                           312
//

If you have problems or comments...

PBIL Back to PBIL home page