(data stored in ACNUC27125 zone)

EMBL: CP000828.PE272

CP000828.PE272       Location/Qualifiers
FT   CDS_pept        273972..276167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0277"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25363"
FT                   /db_xref="GOA:B0C8X3"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR024370"
FT                   /db_xref="UniProtKB/TrEMBL:B0C8X3"
FT                   /protein_id="ABW25363.1"
FT                   /translation="MIPKPPYPQYACPQGNPLTCTEDSGKGSCSVCHFPGVLSAKTKIN
FT                   GQNQYEIVDFLGQRGNGRLYKATNLSDQSACVLKEYVLPQQTFNSSQMAERREAFIQRS
FT                   GISLADGRAQNFRLVMPVEAIPSPLPSSERYFLVYGGEYTHTTSLKQFLDHQSPLSVAT
FT                   IRNILSQILQSLEFMHQQQFRWISGQVQAGLLHGNLNLDSVLVAEKNPGLLVYLCDFYF
FT                   WESLFTSPFAPQSRPAIAQDLQAVGTIAEYLTTASQDIQPPLDATQIESQSRSDLPLAD
FT                   QQFIQRLTGESAPPFETSEQARQALLSLPPVPLLDRPFSPVTAQKSIPTHPFRWWMGLV
FT                   FAYIFIGSVGIGWLYLRNQTKHSLVTEHIPCCIDQVANVPTGPVQFLAEKQGTWDFLYT
FT                   QPHLLKRNTTLQRELNQAQALLQSWQYQPMSVSQDMLADNPPGAYGQKVMDLLNGDSAN
FT                   FIITNHADNIDPSFGVKPFAYNGIAVFVAFGYAQRENSLPRRLKGKITLQQLRGLYTGK
FT                   IKNWRELGGPNRPVKVYFPNQDGLLRIFERKVLVDESSIAAFRKQIATQVRTSRRIPDQ
FT                   TCVGSFCGFASTTLQLRAVIKDFEDRDSFSIGFDELNKVINQCSVYPLALADKGKVAIS
FT                   PFRLNNHRPITPTTDLCNSKASYSVNNQALQNQTYPLAFSLNVVFARDNRRQPAGQTFA
FT                   NILKTQETQCWLQQLGLVPLRKISAKSACQAKPKTKP"
     atgatcccta agccccccta ccctcaatat gcctgcccac aaggaaaccc tttaacctgc        60
     actgaagatt caggaaaggg aagttgctca gtttgtcatt ttccaggagt tctctcggcc       120
     aaaaccaaaa taaacggcca aaatcaatat gaaattgttg attttttagg ccagcgagga       180
     aacggccgct tatataaggc aaccaatctt tccgatcaaa gcgcctgtgt cttgaaagaa       240
     tatgtgcttc cacagcagac ttttaattct agtcaaatgg ctgagcggag agaagcattc       300
     atccaacgat caggcattag cttagcggat ggtcgcgccc agaactttcg gttggtgatg       360
     cctgtagagg ccatcccatc tccgctgcct tcatctgaac ggtatttcct ggtatacggc       420
     ggtgagtata cccataccac ttctctaaaa cagtttcttg atcaccaatc tcctctatca       480
     gttgcaacaa tacgaaatat tttgtcccag attctgcaaa gtttggaatt tatgcaccaa       540
     cagcaattcc gatggatctc aggtcaggtg caagcgggtc ttctccatgg caatctcaat       600
     ctagatagcg tgttggttgc tgagaaaaat ccaggactac tggtatatct ctgcgatttt       660
     tatttttggg agtctctgtt tacgtcccct ttcgcgccgc aatcccgacc tgcgatcgca       720
     caggatttac aggccgttgg aacaatagct gagtatttaa ccacagcatc ccaagacata       780
     cagccacctt tagacgcaac tcaaatagag agccagagta gatctgacct tcccctggct       840
     gatcaacagt ttattcagcg cttaactgga gagtcagccc ctccctttga aacttctgaa       900
     caggcacggc aagcgctttt gagcttacct cctgttcctc tgttggacag gccattttct       960
     ccagtcacgg cgcaaaaatc gatccccact catccatttc gctggtggat gggattagtc      1020
     tttgcttaca ttttcatagg cagtgtaggt atagggtggc tatacctcag aaatcaaact      1080
     aaacactcac ttgttacaga gcatatccct tgctgtatcg atcaagttgc caatgtgccg      1140
     acaggaccag ttcaattctt agctgagaaa caagggacct gggatttcct ttatactcaa      1200
     ccccacctgc taaaacggaa tacaaccctg cagcgggaat taaatcaggc tcaagcccta      1260
     cttcaatctt ggcaatatca gcccatgtcc gtatcccaag atatgttggc tgataatcca      1320
     cctggagcct acgggcagaa agtgatggac ttgctcaatg gagattcagc aaactttata      1380
     attaccaacc atgcagataa cattgatcca tccttcggtg ttaaaccctt tgcctataat      1440
     ggcatcgctg tctttgtcgc ctttggttat gcccagcgag agaatagcct tcctcgaaga      1500
     ttaaagggca aaattacctt gcaacagtta cgaggtttat atactggcaa aatcaagaat      1560
     tggcgggagt taggcggccc taatcgtcca gttaaagtat atttccccaa tcaggatgga      1620
     ctgctgcgta tctttgagcg aaaagttctg gtggacgaat ctagcattgc agctttccga      1680
     aaacagatag ccactcaggt tcgaacatct aggcgtatac cggaccaaac ctgtgtgggt      1740
     tccttttgcg gttttgccag caccactttg caactccgag ccgtgattaa agacttcgaa      1800
     gatcgagact ccttcagcat tgggttcgat gagttaaaca aagtcattaa tcaatgttct      1860
     gtttatccct tagctcttgc agacaaaggg aaggttgcta tttccccatt tcggttaaat      1920
     aatcaccgtc ccattacacc tacaacggac ttatgcaatt ccaaagccag ttattccgtc      1980
     aataatcagg cacttcaaaa ccaaacgtat cccctcgctt tttccctaaa tgtggttttt      2040
     gctcgcgata atcggcgcca accggctgga caaacctttg ccaatattct caaaacccaa      2100
     gaaacccaat gttggctcca gcaacttgga ctagttcccc tccgcaagat ttctgcaaaa      2160
     tctgcatgtc aggcaaaacc caagacaaaa ccctag                                2196
//

If you have problems or comments...

PBIL Back to PBIL home page