(data stored in ACNUC27125 zone)

EMBL: CP000828.PE278

CP000828.PE278       Location/Qualifiers
FT   CDS_pept        281259..282101
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0283"
FT                   /product="glycosyl transferase WecB/TagA/CpsF family
FT                   protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25369"
FT                   /db_xref="GOA:B0C8X9"
FT                   /db_xref="InterPro:IPR004629"
FT                   /db_xref="UniProtKB/TrEMBL:B0C8X9"
FT                   /protein_id="ABW25369.1"
FT                   /translation="MSLPQPKVLLKPTSAAQMNKSLPEQQVLNSSITALRLNKSMRTIM
FT                   QWAHGGESKSVCVANVHMLMEAYWHDKFSQVLQNADMVTPDGMPLVWMMKLLGRKGQDR
FT                   VAGMDILQSLCQKASEEKVRVFFLGSQKSILDRMRARLEKEYPNLEIAAMKPLPFRPLT
FT                   AAEDQELIEEIHESGAGIVFLSLGCPKQEKWMAEHQGRVQAVMIGLGGAFPVYAGLKKW
FT                   APRWVRQAGLEWLYRLVQEPKRLIGRYTQTIPPFIFLASVQLVAHHLAPKRLLNAFNL"
     atgtctctgc ctcaacctaa ggtcttatta aaaccaacca gcgcggccca aatgaacaag        60
     tcattgccag agcagcaagt tctgaactct tctatcactg ctcttcgatt gaacaaatca       120
     atgcgcacca ttatgcagtg ggcacatggc ggagaaagca aatcagtctg tgttgccaat       180
     gtccatatgt tgatggaagc ctattggcat gataagtttt ctcaggttct gcaaaacgct       240
     gacatggtca cccctgatgg catgccttta gtttggatga tgaaattgct cgggcgtaaa       300
     gggcaagacc gcgtagcagg tatggacatc ctgcaaagcc tttgccaaaa agcttcagag       360
     gagaaggtta gagtattttt cctagggtct cagaaatcta ttttggaccg gatgcgtgct       420
     cgtttagaaa aggaatatcc caatctcgaa attgcggcga tgaagccttt acccttccgt       480
     ccgctgaccg cggctgagga tcaagagctg attgaagaaa tccatgaatc cggtgctgga       540
     atcgtctttt tgtctctagg ttgtcccaag caagagaaat ggatggccga acatcaaggt       600
     cgcgtccaag cggtgatgat tggactcggc ggtgcctttc cagtctatgc aggcttgaaa       660
     aagtgggctc ctcgctgggt cagacaagcc gggcttgagt ggctatatcg cttagttcaa       720
     gagcctaagc gccttattgg tcgctatacc caaacgattc caccttttat ctttctcgcc       780
     tctgtgcagt tagtggccca tcacttggca ccgaaaagat tgcttaacgc tttcaatctc       840
     taa                                                                     843
//

If you have problems or comments...

PBIL Back to PBIL home page