(data stored in ACNUC27125 zone)

EMBL: CP000828.PE280

CP000828.PE280       Location/Qualifiers
FT   CDS_pept        complement(284694..285965)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0285"
FT                   /product="two-component hybrid histidine kinase sensor and
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25371"
FT                   /db_xref="GOA:B0C8Y1"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B0C8Y1"
FT                   /protein_id="ABW25371.1"
FT                   /translation="MAKSLKSKQTKPEQEGERSSTALPQEGEIIRVLLVEDNPGDAFLI
FT                   QGMLGVKRSEDAVQYEITHVDKLEDALQTLAKKDFNVVLLDLSLPDSHGLTTLEKVVAQ
FT                   SPVLPIVVFTGLDDETVAMQAVQQGAQDFLVKGQVTPGSLIHAIRYSIERQQNELALKQ
FT                   KTIELERLNKELRKRSLELEAANTELEAFNYTVSHDLRNPLTGIKTGCALLTAYMGDED
FT                   PRLQKYLGTIQDYTRHMATLLEGLLQLSNIGRNPIQAQVVNLSSTVQTIARQLLQQEPK
FT                   RNVKFVIEPQVNVEGDTHLLWVALENLLGNAWKYTGALEHAQIEFGKTTLTHVSRQPLN
FT                   AAETIAPNQPIYFVKDNGAGFDMSHAERIFLPFQRLTNSEDFSGSGIGLSTVQRIIHCH
FT                   GGQIWFDAVVNQGATFYWTLAYKQ"
     atggccaagt cactcaaatc aaagcaaaca aaacccgaac aagagggaga acgttcctcc        60
     accgccttac cgcaggaagg tgagattatc cgcgtgttgc tggttgagga taatcctggg       120
     gatgccttct tgattcaggg catgctggga gtcaagcgga gcgaagacgc cgttcaatac       180
     gaaatcaccc acgtcgataa acttgaggat gctttgcaaa ccctggccaa aaaagacttt       240
     aatgtcgttt tgctggattt gtcgttacca gatagtcatg ggttaaccac cttagagaag       300
     gtggttgctc aaagtcccgt tctcccgatt gtggtgttca caggcttaga tgacgagacg       360
     gtggccatgc aggccgttca acaaggggcc caagatttct tagtgaaagg ccaagtgaca       420
     ccaggctcct taatccatgc cattcgatat tccattgagc gtcaacaaaa tgagctggcc       480
     ctcaagcaaa aaaccattga attggagcgc ctcaataaag aactccgtaa acggtccttg       540
     gagttagaag cagccaatac tgaactggaa gcctttaact acaccgtctc ccatgatctg       600
     cgcaatcctt taactgggat taaaacaggc tgtgccttac tgacggccta tatgggggat       660
     gaagatcccc gattacaaaa atatctgggc acaatccaag actacacccg gcacatggcc       720
     accttactgg aagggctctt gcagctatcg aatattggtc gcaacccgat ccaggcccag       780
     gtggtgaatt taagctctac agtacaaacc attgccagac agctcttgca gcaagagccc       840
     aagcggaacg tcaaatttgt tatcgaaccc caagtgaatg tagaggggga tacccatctg       900
     ctctgggtgg ccctagaaaa cttattgggg aacgcctgga agtatactgg ggcactggaa       960
     catgcccaaa ttgaatttgg caaaaccacc ttaacccatg tcagccgaca gcccttgaac      1020
     gcggctgaaa ccattgctcc caatcagcct atctattttg ttaaggacaa tggggccgga      1080
     tttgatatga gccatgcgga acggatcttt ttgcccttcc aacgacttac caattctgaa      1140
     gacttttcgg gtagtgggat tggcctctca acggtgcaac gcatcatcca ctgccatggt      1200
     gggcaaattt ggtttgatgc agtggtaaat caaggtgcta cattttattg gaccctggct      1260
     tacaaacaat aa                                                          1272
//

If you have problems or comments...

PBIL Back to PBIL home page