(data stored in ACNUC5340 zone)

EMBL: CP000828.PE283

CP000828.PE283       Location/Qualifiers
FT   CDS_pept        288736..289254
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0288"
FT                   /product="HNH endonuclease family protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25374"
FT                   /db_xref="GOA:B0C8Y4"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="InterPro:IPR029471"
FT                   /db_xref="UniProtKB/TrEMBL:B0C8Y4"
FT                   /protein_id="ABW25374.1"
FT                   /translation="MTVIQPILQNTVVVFSKAYLPLARINIKRAIVLLITGQAESLDFG
FT                   NTQVWEVRSPNQVLRVSEHIRLLMGNPERMWKIPPVNRREVLKRDQHRCQYCGSHRRLT
FT                   LDHVIPRSKGGLHTWDNVVAACEPCNSTKSDRTPTQAGMTLQSKPKAPIHPAVAFADQF
FT                   WKSQENLTH"
     atgaccgtta tccaacctat tctccaaaac accgtggtcg tcttttctaa ggcctacttg        60
     ccgttggccc ggatcaatat caagcgggcc attgtgcttc tgatcacggg tcaagcggaa       120
     tctctcgatt ttggcaatac ccaggtatgg gaagtgcgat cgcccaatca agtcttgcgg       180
     gtatcagagc atatccgctt gttgatgggc aacccagagc ggatgtggaa aatacctccc       240
     gttaaccgcc gcgaggtcct caaacgcgat cagcaccgct gccaatactg cggtagccat       300
     cgccgactga cgttggatca cgtgattccc cgatcaaaag ggggattgca cacttgggat       360
     aacgtggttg ctgcctgtga gccttgtaat tccaccaaaa gcgaccgaac gcccacccaa       420
     gcagggatga cgttacagtc caaacccaag gcaccgatcc atccggctgt ggcctttgcc       480
     gaccagtttt ggaaaagcca agaaaaccta acccattaa                              519
//

If you have problems or comments...

PBIL Back to PBIL home page