(data stored in ACNUC8465 zone)

EMBL: CP000828.PE284

CP000828.PE284       Location/Qualifiers
FT   CDS_pept        289313..289696
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0289"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25375"
FT                   /db_xref="UniProtKB/TrEMBL:B0C8Y5"
FT                   /protein_id="ABW25375.1"
FT                   /translation="MLKLIYTELGLHMEYVGDSLETVVSQHVVLTVRTSQTLHLELGQA
FT                   SFLLPVLTPGLGALETALRQYDQTLEITRVDAEYVEVCLAGTWIAQTAQAHEGMFLAAY
FT                   DYETELILRRLWQASDQALTSVV"
     atgctgaaac tgatctatac cgaattggga ctgcatatgg aatatgtagg ggattcccta        60
     gaaaccgttg tgtctcaaca tgttgtgctt accgttcgta ctagccaaac cctccattta       120
     gaactggggc aggcctcatt cttactccca gtgttgaccc ctggcttagg ggctttagaa       180
     acggcacttc gccaatatga ccaaacccta gaaatcactc gtgtggatgc ggaatatgtc       240
     gaagtttgcc tcgctgggac ctggatagcc caaacggccc aagcccatga ggggatgttc       300
     ttagccgcct atgactatga gactgagtta attcttcgtc gtctctggca agcttctgat       360
     caggccctaa cctctgttgt ttag                                              384
//

If you have problems or comments...

PBIL Back to PBIL home page