(data stored in ACNUC27125 zone)

EMBL: CP000828.PE285

CP000828.PE285       Location/Qualifiers
FT   CDS_pept        289900..290640
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0290"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25376"
FT                   /db_xref="UniProtKB/TrEMBL:B0C8Y6"
FT                   /protein_id="ABW25376.1"
FT                   /translation="MRRIIGLAILEDEVIITSGLQPPLHRERSFYSHQGTSYWSYFRAV
FT                   VKRPRLPGLFLLSPRIVAVSDIRYHDSPFSHLSLETSSSLTTIDPGIIITAGCGVDIGQ
FT                   EQRTLFLVICRNRIKFFIHFCGGLFHPITLELKQRGKSLAGRLRNLLQELHFSELPTSL
FT                   SLSSNFNWSQQELSRLERSWKKPISQEVHIVNAQMDNHLQEISKDISEDFNFVIHQNYY
FT                   TVYEQGLQVLCTDTSLTQLIRIAS"
     atgcgtcgaa ttattggact tgcaattcta gaagatgaag taattattac ttctggatta        60
     cagcctcctc tgcatcgaga gcgatcgttc tattctcacc aagggactag ctactggtct       120
     tactttcgtg cagttgtgaa gcgacctcgc ctgccaggtt tattcctgct ctctcctaga       180
     atagtggccg tcagcgacat ccgttatcac gattctccct tcagccacct atctctagaa       240
     acgtcctcat cactcactac tattgatcct ggcatcatca ttacagctgg ctgtggtgtg       300
     gatattggcc aagaacagcg tactttattc ctggttatat gtaggaatcg gattaaattt       360
     tttatccact tctgtggagg tctatttcac ccgatcaccc tagaactaaa acaacggggg       420
     aagtctctgg ctggtcgatt gaggaatctc ttacaggaac tccatttctc agagttacca       480
     acttccctct ctctctcttc caactttaat tggtctcagc aagagctatc gagacttgag       540
     cgtagttgga agaaacctat ctcacaggag gttcatattg tgaatgctca aatggacaac       600
     caccttcaag aaatatcgaa ggatatttct gaagacttta atttcgtgat ccatcaaaat       660
     tactacactg tttatgagca gggattgcaa gtactttgca ctgatacatc cttgactcag       720
     ctcataagaa tcgcgagttg a                                                 741
//

If you have problems or comments...

PBIL Back to PBIL home page