(data stored in ACNUC8465 zone)

EMBL: CP000828.PE287

CP000828.PE287       Location/Qualifiers
FT   CDS_pept        complement(292638..292898)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0310"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25378"
FT                   /db_xref="UniProtKB/TrEMBL:B0C8Y8"
FT                   /protein_id="ABW25378.1"
FT                   /translation="MVKRKVLVDTEPVRIDFHLNGSFTRLKSLQFRRQLEIPTQIIPAH
FT                   LRAIGSCFFLTQIYEYPEPGEEGKPCFRWQIQEKSKANSYF"
     atggtgaaaa gaaaagtact tgtggatact gaacctgtac gtattgactt tcatctaaat        60
     ggaagtttta cacgcctgaa gtctcttcag tttcgtaggc agctagagat cccaactcaa       120
     attattccgg cccatttaag agctattggc tcttgttttt tcttgactca aatttatgaa       180
     tatcccgaac ctggagaaga agggaaaccg tgctttcgat ggcagatcca agaaaaatca       240
     aaagctaaca gttattttta g                                                 261
//

If you have problems or comments...

PBIL Back to PBIL home page