(data stored in ACNUC5340 zone)

EMBL: CP000828.PE288

CP000828.PE288       Location/Qualifiers
FT   CDS_pept        293486..294106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0313"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25379"
FT                   /db_xref="UniProtKB/TrEMBL:B0C8Y9"
FT                   /protein_id="ABW25379.1"
FT                   /translation="MKIKTISILALLMIGMTVNMPSIAQYSRTRYGVDVELYTFVDSYN
FT                   PRQNQESGDIEIKITNKTDKKIELPSQYDGSAISLFALQETEDPRARVMDQHLIVRNAT
FT                   SRPKKKFLSPGETYSYGKLPLNRIFDKEIIGSEGKYYWNWLLHAPPKATPIYDNKWEFE
FT                   ADKLVDTVVLWAEVKIGDQITRSTPKIISIQNQEFNEPEVEAD"
     atgaagatca aaacaatttc catcttggca ttgctgatga ttggaatgac ggttaatatg        60
     ccgagcatcg cccagtattc tagaacaaga tatggtgtgg acgttgaact atataccttc       120
     gttgattctt ataatccaag gcaaaatcaa gaatctggtg atatcgaaat aaaaatcacg       180
     aataaaacag ataagaaaat cgagttgcca agccaatatg atggttctgc tattagctta       240
     tttgctcttc aagagactga agacccccga gctagagtaa tggatcaaca tctaatcgta       300
     aggaatgcta ccagccgccc gaaaaaaaag tttttgtctc caggggaaac ctactcatat       360
     ggcaagctgc ctttaaacag gatattcgat aaagaaataa tcggaagtga agggaagtac       420
     tattggaact ggcttttaca tgctccgcca aaggcaacac ccatctatga caataaatgg       480
     gagtttgagg cagataaatt ggttgataca gtcgttcttt gggcagaagt caagattggc       540
     gatcaaatta cacgatctac cccgaaaatc atcagtattc agaatcaaga gttcaatgaa       600
     cctgaagtag aagctgatta a                                                 621
//

If you have problems or comments...

PBIL Back to PBIL home page