(data stored in ACNUC27125 zone)

EMBL: CP000828.PE292

CP000828.PE292       Location/Qualifiers
FT   CDS_pept        296509..297024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0319"
FT                   /product="appr-1-p processing enzyme family"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25383"
FT                   /db_xref="InterPro:IPR002589"
FT                   /db_xref="UniProtKB/TrEMBL:B0C9U3"
FT                   /protein_id="ABW25383.1"
FT                   /translation="MDTRTEIVQTDITTLKVDAIVNAANESLLGGGGVDGAIHRTAGPQ
FT                   LLAECRTLKGCKTGHAKLTKGYQLPAKYVIHTVGPIWRGGGANEAILLQACYQRSLALA
FT                   VDNGIQTIAFPAISCGVYGYPIDQACQIAFETTLNFLQMNQSITQVIFACFGDLIYHTY
FT                   LKIGEQVN"
     atggataccc gaaccgaaat agtccaaact gatatcacaa ccctaaaggt agatgcaatc        60
     gtcaatgcgg cgaatgagtc cttactcggc gggggtggcg tcgacggagc gattcatcgt       120
     acagccggcc cccaactcct agcagaatgc cgaaccctta aaggctgtaa aacgggccat       180
     gccaaactca caaaaggata tcaacttcca gctaagtatg tcattcacac tgttggtccg       240
     atttggcgag gcgggggagc caatgaagcg attttattgc aagcctgcta tcaacgcagt       300
     ttagcgttag ccgttgacaa tgggattcaa accatagcct ttcctgccat tagttgcgga       360
     gtctatggat atccgataga tcaagcctgt caaatcgcct ttgaaacgac cctcaatttc       420
     ttgcagatga atcaatccat aacccaggtt atctttgcct gctttggcga cttgatttat       480
     cacacctacc taaaaatagg ggagcaggtg aattaa                                 516
//

If you have problems or comments...

PBIL Back to PBIL home page