(data stored in ACNUC8465 zone)

EMBL: CP000828.PE298

CP000828.PE298       Location/Qualifiers
FT   CDS_pept        301774..303201
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0330"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25389"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="InterPro:IPR037214"
FT                   /db_xref="UniProtKB/TrEMBL:B0C9U9"
FT                   /protein_id="ABW25389.1"
FT                   /translation="MNTAEQDLRLEMLNSLLTTPHRKLEQVAETHQLMVEVDPLFYGHL
FT                   AVWYQRYGDVRDHKEVFVSHLLTSGMADHRGAGFVLLQGLPPYQVARVIDFMKQKLGKV
FT                   PRSTRTAVRRYLTRREQNPKQFDRAALRARKAIKHLYATLHIKPGARADAILFKNDPPD
FT                   GSLAKVLKQIANAPHPSEQARLIVEFKIPYAIATGSIQQLTPTVLAALIHNMSPQEVIN
FT                   HLKSLKARGAMDHAEMKQLIDDKLGKAQTDTRISAFKAQVAAEAVDVDAETTAKLEKVT
FT                   DKQVKRRGTIGKSTALLVDKSGSMSSAIEVGKRLAAMISGISQADLFVYAFDTIPYPVQ
FT                   SQGSDLSDWERAFKLIKAGGGTSLGCALEVMCQHQQKVDQIILVTDEGGNTTPYFAETY
FT                   QRYCREFGLLPNVVIVRVGHAYKLVENQLRQQQAPVETFTFQGDYYALPNLVPLLTRPS
FT                   RLELLMEIMETPLPIRY"
     atgaatactg cagaacagga tttacgtcta gaaatgctga atagcttgct aaccacccct        60
     catcggaagt tggagcaagt ggcggaaaca caccagttaa tggtggaagt agacccgcta       120
     ttttatggtc atctagcggt ttggtatcaa cgttatggtg atgtgcgtga ccacaaggag       180
     gttttcgtca gtcacctgtt aactagtggc atggcggatc accgaggagc gggatttgtc       240
     ctgttgcaag gactgccccc ataccaggtg gcccgcgtca ttgactttat gaagcagaag       300
     ttgggcaagg tccctcgatc aacccgcact gcagttcgcc gttatctaac tcggcgagag       360
     cagaatccaa agcagtttga tcgagccgcg ttacgggcac gaaaagccat caagcatctc       420
     tatgcgaccc tgcacattaa gccgggagct cgggctgatg ccattctgtt caagaatgat       480
     ccacctgatg gatcgctggc aaaagtcctc aaacagattg caaatgcacc gcacccaagt       540
     gaacaggcgc gattgattgt ggagtttaag attccctatg cgatcgcaac ggggtctatc       600
     cagcaactca cccccacagt gctggctgcc ttaattcaca atatgagtcc ccaagaggtg       660
     atcaaccacc ttaagtccct aaaagcacgg ggggcaatgg accatgctga gatgaagcag       720
     ctcatcgatg acaaattggg aaaggcccaa acagacaccc gaatctctgc cttcaaagcc       780
     caagtggcag cagaggcagt cgacgtggat gcggaaacaa ctgccaaact ggaaaaggtc       840
     accgataagc aggttaagcg acgtggaacc atcggtaagt caacagcatt gctggtggac       900
     aagtctggtt ccatgagcag tgcgatcgag gtgggaaagc gactggctgc catgatttct       960
     ggcattagcc aagcggatct atttgtctat gcctttgata cgattcccta cccagtccag      1020
     tcccaaggct cagacctgag tgactgggag cgagctttta agctaatcaa agctgggggc      1080
     ggtactagtt tggggtgtgc gttggaggtg atgtgtcagc accagcaaaa ggttgaccaa      1140
     attattttgg ttaccgatga agggggaaat acaacgccct attttgctga aacttaccag      1200
     cggtattgtc gggaatttgg ccttttgccc aatgttgtaa ttgtgcgagt gggccatgcc      1260
     tacaagttgg tggaaaacca gcttagacag cagcaagccc cagtggaaac gttcacgttc      1320
     caaggagatt actatgcact acccaatttg gtacccttac tgactcgccc ttctcgactg      1380
     gagttgctga tggaaatcat ggagactcca ttgcccattc ggtactaa                   1428
//

If you have problems or comments...

PBIL Back to PBIL home page