(data stored in ACNUC5340 zone)

EMBL: CP000828.PE307

CP000828.PE307       Location/Qualifiers
FT   CDS_pept        complement(311477..312157)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0338"
FT                   /product="peptidase M23 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25398"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:B0C9V8"
FT                   /protein_id="ABW25398.1"
FT                   /translation="MSLSLACGLGSGCSLLSVRPAPSMPEGGAFPDPPTSMPSLLLNRL
FT                   GVKQWFDNRRGTHPLTDLPSTAMKGYCHPLQGKGFLSQGTRGNTHQGRMKYAYDFGVPI
FT                   GMPVYAMQGGRVIGLRDKYPDKGGRRRNAEKFNFIWLEHSNGVRSAYIHLQQNFKKKIP
FT                   IKLNDWVRTGDLIGYSGNSGWSSAPHLHVEVHSISESGFGQTLPFEIVSKCHNTPFASV
FT                   RQAS"
     gtgagtttgt cgttggcttg tggtttaggc tcgggttgct ccctattgtc agttcgaccc        60
     gctccatcca tgccagaagg aggggctttc ccagatcccc ccactagcat gcccagtctt       120
     cttctcaatc ggttaggggt taagcagtgg tttgataatc gtcgaggaac tcatcccctg       180
     acggatctgc ctagtacagc catgaaaggc tattgtcacc cccttcaagg caaagggttt       240
     ctcagtcaag gaacccgagg caatactcat caaggccgga tgaaatatgc ctatgacttt       300
     ggtgtaccca ttggcatgcc cgtttatgcc atgcagggtg ggcgagtgat tggcttgcga       360
     gataaatatc ccgataaagg gggaagacgt agaaatgcgg agaagtttaa ctttatttgg       420
     ctagaacata gtaatggagt ccgttcagcc tacattcatt tgcagcagaa ctttaaaaag       480
     aaaatcccaa tcaagttgaa tgattgggtg agaacggggg acctcattgg ctacagcggc       540
     aattcgggtt ggagttcggc tccccactta catgtcgaag tccatagtat tagtgaatct       600
     ggctttggcc aaaccttgcc gtttgaaata gtctctaagt gccataacac tcctttcgcc       660
     agcgttcgtc aggcttcata a                                                 681
//

If you have problems or comments...

PBIL Back to PBIL home page