(data stored in ACNUC27125 zone)

EMBL: CP000828.PE309

CP000828.PE309       Location/Qualifiers
FT   CDS_pept        313423..315324
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0341"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25400"
FT                   /db_xref="InterPro:IPR005532"
FT                   /db_xref="InterPro:IPR016187"
FT                   /db_xref="InterPro:IPR029030"
FT                   /db_xref="InterPro:IPR042095"
FT                   /db_xref="UniProtKB/TrEMBL:B0C9W0"
FT                   /protein_id="ABW25400.1"
FT                   /translation="MGKNWAIAIGINDYQNMRPLKFARKDAEAVCQFFQESLHFDKVDL
FT                   FAKGAEPVRYEDGPPIQADPTVGNLDTFFDVRFEHPFLEPGDNLWFFFAGHGKRHKGRD
FT                   YLMPIDGSPRRVERMGIAIDYIAERLRRSGADNVILMIDACRGEDDRDGGEGVGRQQQK
FT                   GIITLFACSPNELSYEIEEIEQGAFTHTLLAGLQIQGAGNCATVERLSQYLRAQVPEVN
FT                   RRYNKPAQTPYTRIEPESKLHFILLPGQATLQDVATMKIDALVAETENDLDGAEHLWTR
FT                   VLAASQADFQAIKGLQRIAVKRATGQSLRSTPTPSPETLTTGADNSSREPASNLPPESK
FT                   DNLADNKPSKPQPSRVTFSVVKVNAQGEVIEQQEQQTEQSLVMLPGEVPLSLVHIPQGK
FT                   FWMGAQKNEIDAQDTEYPRHQVSVPSFWMGQYPVTQRQWQAIAGLSKVKVDLDPDCSNF
FT                   KGEALPVEKVSWYQAVEFCERLSRHSGQDYRLPTEAEWEYACRAGTETPFYCGETITTD
FT                   QANYCGDATYGNGPKGQYRSKTIAVGSSAANAFGLFAMHGNVWEWCLDHWHEDYTNAPT
FT                   DGTAWLSENDNHYRLLRGGSWGNSPRSCRSASRLRLRPDSQNDCVGFRVVCVSARAF"
     atgggtaaaa actgggcaat tgccattggg attaacgatt atcaaaatat gcgtccgctg        60
     aaatttgccc gaaaagacgc ggaggcggtg tgccagtttt ttcaggagtc cttgcatttc       120
     gataaggtag atttgtttgc caaaggggca gagcctgtcc gctatgaaga tggtcctccc       180
     attcaagctg accctactgt cggcaattta gatacgtttt ttgatgtccg gtttgaacac       240
     ccatttctag agccaggaga taacctgtgg tttttctttg ctgggcatgg caaacgccac       300
     aaggggcgag attatttgat gccgattgat ggcagccccc gtcgtgttga aaggatgggt       360
     attgccattg attatattgc tgagcgactg cgacgtagtg gggcggataa tgtgattttg       420
     atgattgacg cctgccgagg cgaggatgat cgggatgggg gtgaaggggt gggtcggcaa       480
     cagcagaaag ggattattac tctgtttgcc tgtagcccca atgagctgtc ctatgaaatt       540
     gaggagatag agcaaggggc gtttacccat acgctgcttg ccggactcca gatccagggg       600
     gcgggtaatt gcgcgacggt ggaacgtttg agccaatacc tgagggcgca ggtgcccgag       660
     gttaaccgtc ggtataataa acctgctcag acgccatata ctcggataga acctgaatcg       720
     aagctgcatt ttattttgct gccggggcaa gccacgctgc aagatgtagc cacaatgaaa       780
     attgatgccc tggtagctga gacggaaaat gatttggatg gggctgagca tctgtggact       840
     cgggtgttag cagcttctca ggcagacttt caagcgatta agggattaca gcgaattgcg       900
     gtcaaacggg caacgggcca gtcccttaga tcgacaccga ctccaagtcc agagacgcta       960
     accactgggg ctgataactc ttcccgagaa cctgcgagta atcttccgcc agaatcgaag      1020
     gacaacctgg ctgacaacaa accgtctaaa cctcaaccct caagggtgac gttttcggtg      1080
     gtcaaggtga atgcccaagg cgaggtgatt gagcagcaag agcaacagac agaacaaagc      1140
     ttggtaatgt tgccgggaga agtcccccta tctctggttc acattcccca ggggaagttt      1200
     tggatgggtg cccagaagaa tgaaatagat gctcaagata ctgaataccc taggcatcag      1260
     gtatcggtgc cctctttttg gatggggcaa tatccggtaa cacaacgaca gtggcaagcg      1320
     attgcggggc tgagcaaagt caaggtggat ctggatccag actgttccaa tttcaaagga      1380
     gaggctttac ctgtggagaa ggtgtcttgg tatcaggccg ttgaattttg tgagcgccta      1440
     tcacgacatt ccggccaaga ctatcggtta ccgactgagg cagagtggga atatgcctgt      1500
     cgagcgggta ccgaaacccc tttttattgt ggggaaacta ttacaacaga tcaagccaat      1560
     tactgtggtg atgccaccta tgggaacggt ccaaaagggc agtatagatc gaaaaccata      1620
     gccgtcggtt catctgctgc caatgccttt ggcttatttg ccatgcatgg caatgtctgg      1680
     gaatggtgtc tggatcattg gcatgaggat tatacaaacg ctcctaccga tgggactgct      1740
     tggttaagtg aaaatgataa tcattatcgt ctgctgcggg gcggttcctg gggcaactct      1800
     ccgaggagct gccgctcggc ctcgcgcctc aggctcaggc ccgactccca gaacgactgc      1860
     gtcggtttcc gtgtcgtgtg tgtttcggcg agggccttct ag                         1902
//

If you have problems or comments...

PBIL Back to PBIL home page