(data stored in ACNUC27125 zone)

EMBL: CP000828.PE313

CP000828.PE313       Location/Qualifiers
FT   CDS_pept        317020..317865
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0345"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25404"
FT                   /db_xref="InterPro:IPR000477"
FT                   /db_xref="UniProtKB/TrEMBL:B0C9W4"
FT                   /protein_id="ABW25404.1"
FT                   /translation="MRLISAAPYRDRVVHHALCNVIIPVFEPTLISDSYANRWGYGTHR
FT                   AVQRFTQFARSSRYVLQCDIRKYFPSIDHGLLKAGLRRKIKCPKTLWLIDQIIDHSNPQ
FT                   ATVLEYFPGDDLLTPLAHRRGLPIGNLTSQFFANVYLNGFDHFVKEQLKTKKYVRYVDD
FT                   FALFDDSREQLVQARQAIEAYLNQLRLKIHPIKSQIVATHHGVAFLGFRIFPAHIRVQN
FT                   ANIRRSRKRLRKLQKAYAQGEISATMIDQSIQSWVAHLSHADTWQLRQRIFADLVFARQ
FT                   "
     ttgcggttga tatcggcggc cccctatcgg gaccgagtcg ttcaccatgc cctttgcaat        60
     gttattattc cggtgtttga accgacgctt attagcgatt cctatgccaa tcggtgggga       120
     tatggcaccc atcgagccgt gcagcggttt acgcagtttg ctcgctccag ccgatatgta       180
     ttgcagtgcg atattcgcaa atatttcccc tccattgatc atggcctgct gaaggctggc       240
     ctacgccgca aaatcaagtg tccaaaaacc ctctggctga ttgaccaaat catcgatcac       300
     agcaatcccc aagcaacagt ccttgaatat ttccccggtg atgatttact cactcccctt       360
     gcccatcgcc gagggctacc tattggcaac ctaaccagtc agttttttgc caatgtctat       420
     ctgaatgggt tcgatcactt tgtcaaagag cagttgaaaa ccaaaaaata cgtcagatat       480
     gtggatgact ttgccctgtt cgatgacagc cgtgaacagt tagttcaagc tcgccaagct       540
     atcgaagcct atttaaacca actccgactc aaaattcatc cgatcaaaag ccaaatcgtc       600
     gccacccacc atggcgtcgc ttttttggga tttcggattt tccccgctca tattcgcgtc       660
     cagaatgcca atatccgcag gagccgtaaa agattacgaa aactacaaaa agcctatgca       720
     caaggtgaaa ttagtgccac gatgatcgat caatcgattc aaagttgggt tgcccacctt       780
     agccatgctg atacttggca actgcgacaa cggatatttg ctgaccttgt gtttgcaagg       840
     cagtag                                                                  846
//

If you have problems or comments...

PBIL Back to PBIL home page