(data stored in ACNUC8465 zone)

EMBL: CP000828.PE316

CP000828.PE316       Location/Qualifiers
FT   CDS_pept        complement(319792..320358)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0348"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25407"
FT                   /db_xref="UniProtKB/TrEMBL:B0C9W7"
FT                   /protein_id="ABW25407.1"
FT                   /translation="MSLLVLFVGAIASLTWARAQTELLPQTKLNAVQAQLLPKAIQSES
FT                   PTAGSTTIEQLETILRDEASDVQVEQGQISFKYDGRTMLILTSAQHDRMRILAPIKKAA
FT                   EITPEQRDNMLLANFHTALDGRYAVSNGIVFATFLHPLSSLQDRDFRSALSQVNQLVQN
FT                   FGTTYSSGAIGFGAGQEQPEPLPAI"
     atgtctctat tagttctgtt tgtgggagcg atcgcctcct tgacttgggc gagggctcag        60
     accgaactcc tgccgcagac aaagctcaat gcagttcagg ctcagctcct tcccaaagcc       120
     attcaatccg aaagtcccac agcaggatcg accaccattg agcagctgga aacgattctg       180
     cgggatgaag cctccgatgt tcaagttgag caagggcaga ttagctttaa gtatgacggg       240
     cgaaccatgc tcatactgac tagtgcgcag catgatcgga tgcgaattct ggctcccatc       300
     aaaaaggcag cggagatcac cccagaacag cgggataata tgctgcttgc caatttccac       360
     accgctttgg atggtcggta tgcagtcagt aatggcattg tctttgctac ctttcttcat       420
     cccctgtctt cgctgcaaga tcgcgatttt cggtcagcct tgagtcaggt taatcaactc       480
     gttcagaatt ttggtacgac ttattcgagt ggggcgatag gatttggggc gggtcaagaa       540
     cagccagaac ctctgccagc catttaa                                           567
//

If you have problems or comments...

PBIL Back to PBIL home page