(data stored in ACNUC27125 zone)

EMBL: CP000828.PE319

CP000828.PE319       Location/Qualifiers
FT   CDS_pept        321604..321723
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0351"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25410"
FT                   /db_xref="UniProtKB/TrEMBL:B0C9X0"
FT                   /protein_id="ABW25410.1"
FT                   /translation="MAKANGVTNLTVFLARVWSHTLLYQQMPAMLQAFAPFPP"
     ttggcgaagg ccaatggtgt aaccaatttg acagttttct tagccagagt atggtcacac        60
     actcttctct atcagcaaat gcctgcaatg ctgcaggcat ttgctccctt cccgccataa       120
//

If you have problems or comments...

PBIL Back to PBIL home page