(data stored in ACNUC5340 zone)

EMBL: CP000828.PE32

CP000828.PE32        Location/Qualifiers
FT   CDS_pept        complement(37033..37587)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0035"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25123"
FT                   /db_xref="InterPro:IPR022203"
FT                   /db_xref="UniProtKB/TrEMBL:B0C511"
FT                   /protein_id="ABW25123.1"
FT                   /translation="MEMDRSTVTLMDEAGRSLTCFVEVSVPIDQEEYALLNPVDYPVDI
FT                   FGWVVTDEEDEIVQPVEEQELAKIFPTAQAVLSEQNLKLKRSALSLTVEGDLPDIDEEE
FT                   ILVLEMEEGDEISEQEEYQLLATFFEEEQEYSIYTPIDPVLFVVRLRENMQPELLSPQE
FT                   FQALQPKLQPLLEERLMDDLD"
     atggaaatgg accgttctac ggtgacgttg atggatgaag caggacgttc tttgacctgc        60
     ttcgttgaag tatctgtgcc aatcgatcaa gaagaatatg ctctcctgaa ccctgtcgat       120
     tatccagtag acatttttgg ttgggttgtt accgatgaag aggatgagat tgtccagcct       180
     gtagaagaac aagagctggc gaagatattc cccacggctc aagctgtatt atccgaacag       240
     aacttgaaat tgaagcgaag tgccttgtct ttaaccgtag aaggtgatct tccggatatt       300
     gatgaagaag aaattctggt tttggaaatg gaggaggggg atgagatttc tgagcaagag       360
     gaatatcaac tcttagcgac tttttttgag gaggaacaag agtattcgat ctatactcca       420
     atagatccag tgctgtttgt tgttagactg cgtgagaata tgcagccgga gctgctttct       480
     cctcaagagt tccaagctct tcaacccaag cttcaacctc tgctggagga acgtctaatg       540
     gacgatttag actaa                                                        555
//

If you have problems or comments...

PBIL Back to PBIL home page