(data stored in ACNUC27125 zone)

EMBL: CP000828.PE320

CP000828.PE320       Location/Qualifiers
FT   CDS_pept        complement(321726..321998)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0352"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25411"
FT                   /db_xref="UniProtKB/TrEMBL:B0C9X1"
FT                   /protein_id="ABW25411.1"
FT                   /translation="MRSQLAIHLEQMGLTQSIQVEFLYLPSYSPKLNLVEYVIHLLRLR
FT                   CLHHLPLGTTLTQIKQQLHEFFAANQFLSAEQVQNSLNFIFSLVP"
     atgcgctccc aactcgctat ccatctagag cagatggggc tcacccaatc gattcaagtt        60
     gagtttttat atttgccgtc ctactctccc aagttgaact tggttgaata tgtgattcac       120
     ttactacgct tacgatgtct gcaccatctc cctcttggaa cgaccctgac acagatcaaa       180
     caacagctcc atgagttctt tgctgctaac cagtttctat cggctgaaca agttcaaaac       240
     agcctgaatt ttatattttc acttgttcca taa                                    273
//

If you have problems or comments...

PBIL Back to PBIL home page