(data stored in ACNUC5340 zone)

EMBL: CP000828.PE323

CP000828.PE323       Location/Qualifiers
FT   CDS_pept        complement(323247..323780)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0355"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25414"
FT                   /db_xref="GOA:B0C9X4"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025959"
FT                   /db_xref="UniProtKB/TrEMBL:B0C9X4"
FT                   /protein_id="ABW25414.1"
FT                   /translation="MNRTQAFLDKPFDADEWQKFYYRNQQHYIRQRLTAIKLLNEGHSR
FT                   TQVSEQVGCSYDTLTRWMDKYLDGGLQGLVQSIRHQKPSRLSPEEQQQLKEMVLTQRPT
FT                   DYGIDRNMWTGAILAVVIEQRFEVQLKDSRIYELLSELGLSYQRAHRDYANADLNAQKE
FT                   WVAAVKKTAITTIG"
     ttgaatcgaa cacaagcctt tctggacaag ccttttgatg cggatgagtg gcagaaattc        60
     tactaccgca atcaacaaca ctacattcga cagcgcttga ccgcgatcaa attgctgaat       120
     gaaggacaca gtcgtaccca agtgagcgaa caagtggggt gtagctatga tacgttaacg       180
     cgttggatgg acaaatatct cgatggtgga ctccagggct tggtccaatc cattcgacat       240
     caaaaaccta gtcggttgag cccagaggaa caacaacaac tcaaagagat ggttctgacg       300
     caacgtccga cagactatgg tattgaccgc aatatgtgga caggtgcaat tttagccgtt       360
     gtgattgagc agcgtttcga ggtgcagctg aaagattcgc gtatctacga attgctatca       420
     gagttggggt tatcttacca acgcgcccat cgtgactatg cgaatgctga cctgaacgcc       480
     cagaaagagt gggtggcggc tgttaaaaaa actgcaatca cgacaatcgg atga             534
//

If you have problems or comments...

PBIL Back to PBIL home page