(data stored in ACNUC27125 zone)

EMBL: CP000828.PE324

CP000828.PE324       Location/Qualifiers
FT   CDS_pept        complement(323887..325581)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0356"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25415"
FT                   /db_xref="InterPro:IPR021787"
FT                   /db_xref="UniProtKB/TrEMBL:B0C9X5"
FT                   /protein_id="ABW25415.1"
FT                   /translation="MVKLRSVFLQLLASVLALLIWSGPVWALEPEPELAPPQPEPELGP
FT                   ESAHFMPDTTSLMVSLTGSPLKMAGNESAGASSQLTDLPATLLATGGIDYQKDIRPWVS
FT                   DEMTFALTSLEKGQPGYLLAVKTRNNRDADAFLERIWQQQATDGQTINFERYAGVDLIS
FT                   ADMSPNVATSARLPGLLKPVRYLTTAKLDDRFVLIANQRQVLEQAVDSSKKPATQLAKR
FT                   SEYKTAIASLTQKQQSGMAYLDLEKLLPAISGQAATTPPTYRSLGIAFGESRQGLLAET
FT                   ALVAKAGRDLPAVKTTQQEPMAALSYFPGNSPFVVSGSNLGTLWSQINQDLQGYPNLKS
FT                   WVNQTLGTWGKTHGLNLTSKIFPWVDGDYAWALLPDSLSPVLSAQANSEADWLFAYEQT
FT                   NSDKNKQLATHLNELATEQDLGTSPFELAGRKVYAWTRLVSQEIDDTRGSNLTFKTEVT
FT                   GAYANIDNQKILASSPEALGLALDAGSDALTNQRSFQDAIAPFDQPNQGFLYIDWPVMK
FT                   PILKKNLPVISKLESNAQTLLSKLRSVSISSYGETSEVQHSQWYFRF"
     atggtaaaac ttcgttctgt ttttcttcag ttactagcca gtgttcttgc cctgctgatt        60
     tggagcggac ccgtctgggc ccttgagcct gaacctgaat tggccccgcc tcagccagag       120
     cctgagttag gccctgaatc ggcccatttt atgcctgata caacgtcttt aatggtttcg       180
     ttgacgggga gcccattaaa gatggctgga aatgagtcag caggagcctc ttcccaacta       240
     acggatttac ctgcgacttt gctggccact gggggcatcg attatcaaaa ggatattcgc       300
     ccctgggtga gtgacgaaat gaccttcgcc ttgaccagtt tggagaaagg gcagcctgga       360
     tatttgctgg cggttaaaac ccgaaataat cgggatgcag atgccttctt ggagcggatt       420
     tggcagcagc aggccacgga cggccagacg ataaattttg aacggtatgc tggggtcgat       480
     ctgatttcgg cggatatgtc gcccaatgtg gctacgtctg ctcgtctacc aggattgttg       540
     aagccggttc gatatttgac caccgctaag ttggatgatc gctttgtctt aattgccaat       600
     cagcgtcagg ttttagagca ggcggttgat tcgtctaaaa aaccggccac gcagttggcg       660
     aaacggtccg agtacaaaac tgcgatcgca tccctgactc aaaaacaaca gtctgggatg       720
     gcctatctgg atttagaaaa gctgcttccg gccatttctg gtcaagcggc caccacccca       780
     cccacctatc gcagcttggg gattgccttt ggtgaatctc ggcaggggct gttggctgag       840
     accgctttgg ttgccaaggc cggacgagac ctacccgccg ttaagacaac ccagcaagag       900
     ccgatggcgg cccttagtta tttccccggc aatagtccgt ttgtggtctc tggatcgaat       960
     ttaggcaccc tatggtctca aatcaaccag gatttgcaag gctatcccaa tctcaaatct      1020
     tgggtgaatc aaactctcgg cacttggggg aaaacccacg gcctcaacct caccagcaaa      1080
     attttccctt gggtcgatgg ggactatgct tgggcactgt tgccggattc cttgtcgcct      1140
     gtcttgtcgg ctcaggcgaa ttcagaagca gattggcttt ttgcctatga gcagaccaat      1200
     agcgataaaa acaagcagtt ggcgactcat ttaaatgagc tagcaacgga acaggatcta      1260
     ggcacaagtc cgtttgagct agccggtcgc aaggtctatg cctggacccg tttggtctct      1320
     caagaaatcg atgatactcg cggtagcaac ctcaccttca agacggaagt gacaggggcc      1380
     tacgccaata ttgataacca aaagatcttg gccagctcac ccgaggctct agggttagcc      1440
     ctggatgctg gcagtgatgc cttgactaat cagcggtcgt ttcaagatgc gatcgcaccc      1500
     ttcgatcagc ccaatcaagg gttcttatat atagattggc ctgtgatgaa gcccattctg      1560
     aaaaagaatc tacccgttat ttctaagctg gaaagtaatg ctcaaaccct cctgagtaaa      1620
     ctccggtcgg tatccatcag tagctatggc gaaacgtctg aagtccagca tagtcagtgg      1680
     tatttccgct tttag                                                       1695
//

If you have problems or comments...

PBIL Back to PBIL home page