(data stored in ACNUC5340 zone)

EMBL: CP000828.PE326

CP000828.PE326       Location/Qualifiers
FT   CDS_pept        326354..326494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0358"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25417"
FT                   /db_xref="UniProtKB/TrEMBL:B0C9X7"
FT                   /protein_id="ABW25417.1"
FT                   /translation="MESLGITWGKIIIRENYIFLLSSHHLTIFLAIIQTQATLGSFKQA
FT                   K"
     gtggaaagct tggggataac ctggggaaag ataattattc gagaaaatta tattttttta        60
     ctttcaagtc accatttgac gatttttctg gccatcatac agacccaagc aacattagga       120
     tcttttaagc aagctaaata a                                                 141
//

If you have problems or comments...

PBIL Back to PBIL home page