(data stored in ACNUC5340 zone)

EMBL: CP000828.PE329

CP000828.PE329       Location/Qualifiers
FT   CDS_pept        complement(329102..329899)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0361"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25420"
FT                   /db_xref="InterPro:IPR008775"
FT                   /db_xref="UniProtKB/TrEMBL:B0C9Y0"
FT                   /protein_id="ABW25420.1"
FT                   /translation="MELAIPPTTPSMSLQQTFRQQGYVVIKNFFSPQEMATLIEQIESP
FT                   QSRQCLDQCLTKGTLRFYANLYRHNESIQKFVSQPKIVNFLYPFIGSDFWVRWDQAVAK
FT                   GPGAKTFPWHQDNAYNGFKQTHYQLWVALTSMTIENGGLWLVPGSHHQLLPHRKINDHM
FT                   VYQGEPESPTFITAEVGDIVLFSSLTLHKTTPNTTEGIRWAYVIEYMSTNDYDPGIAPP
FT                   FLKVAKQGQPQAEFVQSYRGRNPINRLKHRLSRREISQILEWQ"
     atggaattag cgataccccc aacgactcct tccatgtccc ttcaacagac ctttaggcag        60
     cagggatacg ttgtcatcaa gaatttcttc tctccccaag agatggcgac ccttattgag       120
     caaatcgaat ctccccagag ccgtcaatgt ttagatcaat gtctaaccaa aggcactctg       180
     aggttctatg ccaacctcta tcgtcataat gaatcgattc aaaaatttgt ttctcagcct       240
     aaaattgtca atttcctcta cccatttatc ggttcagact tctgggtgag atgggatcaa       300
     gcggttgcca aagggccagg cgcaaaaact ttcccctggc accaagacaa tgcctataac       360
     ggctttaagc agacccacta tcaactttgg gtagcgctta cctcgatgac tattgaaaat       420
     ggtggtcttt ggctagttcc tgggagccat caccagctac tgccccatcg aaaaatcaat       480
     gaccatatgg tttatcaagg ggagcctgaa tcacccacct ttattacggc agaggtcgga       540
     gatatcgtcc tgttttcatc tttaactctg cataaaacaa ctcccaacac gacagaaggc       600
     atccgctggg cttatgtcat tgagtacatg tccacaaatg attatgatcc gggtatcgcc       660
     cccccttttc taaaggttgc gaaacaggga cagccccagg cagaatttgt ccaatcctat       720
     cgaggacgta accccattaa ccgtcttaaa catcgtttgt ctcgacggga aattagtcag       780
     attctggagt ggcagtag                                                     798
//

If you have problems or comments...

PBIL Back to PBIL home page