(data stored in ACNUC5340 zone)

EMBL: CP000828.PE331

CP000828.PE331       Location/Qualifiers
FT   CDS_pept        complement(331791..331907)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0363"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25422"
FT                   /db_xref="UniProtKB/TrEMBL:B0C9Y2"
FT                   /protein_id="ABW25422.1"
FT                   /translation="MANVGIPFSVEYSLEMQIEVHIEDARKGKYGLINPGSL"
     ttggccaatg tagggattcc cttctctgtt gaatattctt tagagatgca gatagaggtc        60
     catattgagg atgctagaaa aggtaagtat gggcttatca atcccggctc actatag          117
//

If you have problems or comments...

PBIL Back to PBIL home page