(data stored in ACNUC8465 zone)

EMBL: CP000828.PE335

CP000828.PE335       Location/Qualifiers
FT   CDS_pept        complement(336661..337452)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0367"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25426"
FT                   /db_xref="GOA:B0C9Y6"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B0C9Y6"
FT                   /protein_id="ABW25426.1"
FT                   /translation="MRKTNIITQCRTRAASRRSKIIGNHYPEFNISGYTSVDGTVEFYS
FT                   RINSLLNNSMVVLDFGAGRGSWKEDYSCPYRKSLHDLQGKVKKIVGCDIDEAIYDNPTV
FT                   DEKVVIKIGEKLPFDDNSFDLIISDFTFEHIENENEIAQEFTRILKAGGWICARTPNKY
FT                   NYVYILIQLIRNSWHEQILKYVQPLRNEIDVFPTMYRMNSARKIDILFPDDKYENYTYY
FT                   FNSEPAYFFNNSFLFFIMKIIDSFLPFYLKNNLFIFLKKEI"
     atgcgtaaaa caaatataat cactcaatgt cgaactagag ctgctagcag gcgttcaaaa        60
     ataattggga accattatcc agaatttaat ataagcggtt atacctcagt tgatggaaca       120
     gttgagtttt actcaaggat aaactctctg ttgaataatt caatggtagt gcttgacttt       180
     ggtgctggca gaggctcctg gaaagaagat tattcttgtc cttatcgaaa atcacttcat       240
     gatttacaag ggaaagttaa aaaaattgtc ggttgtgata tagatgaagc aatatatgat       300
     aatccaacag tagatgaaaa agtagtaata aagattggcg aaaagcttcc gtttgacgat       360
     aattcgtttg acctaataat atcagatttt acttttgaac atattgaaaa tgaaaatgaa       420
     attgcccagg agtttactcg cattcttaag gcaggaggtt ggatatgtgc taggactcca       480
     aataaatata actatgttta tattttgatt caactaataa gaaactcttg gcatgagcaa       540
     attcttaagt atgtacaacc tttgagaaat gaaatagatg ttttcccaac tatgtatagg       600
     atgaattctg ctagaaaaat agatatacta ttcccagacg ataaatatga aaattatact       660
     tattatttta attctgaacc tgcatatttc tttaacaata gtttcctttt ttttattatg       720
     aaaattattg atagttttct cccattttat ttgaaaaata atctatttat ttttctaaaa       780
     aaagaaattt ga                                                           792
//

If you have problems or comments...

PBIL Back to PBIL home page