(data stored in ACNUC27125 zone)

EMBL: CP000828.PE337

CP000828.PE337       Location/Qualifiers
FT   CDS_pept        complement(339656..340600)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0371"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25428"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B0C9Y8"
FT                   /protein_id="ABW25428.1"
FT                   /translation="MGKLKDAGKKTLRNLFELGQNLGFDILPHHFYSEIPNINELKKSN
FT                   YWKIPYSMIEVNGIDTQEQIAFVSDCFNTQLIDFLNCNNIHSEASKINNKVGFGPIEAD
FT                   FLFAFISKHQPKQIFQIGCGVSTAVCLKAANYACYAPEIICVEPYPNNYLREIERQGRI
FT                   TLINEKAQSYCPINIEKLDSDVLFFVDSTHTLGPSGEVSRIILEMLPRLKKGAWVHFHD
FT                   IKFPYDYDRNILDSALFFQHESVLLHAFLVGNNRFKICASLSMLHYSCPTVLAQFLTKY
FT                   KPASNDEGLNSYDSLNKQEQFHFPSSTYLKVIT"
     atgggtaaat tgaaagatgc tggaaaaaaa acattaagaa atttatttga gttaggtcaa        60
     aatttaggtt tcgatatact accgcatcat ttttattctg aaatacctaa tattaatgaa       120
     ttaaaaaagt ctaactattg gaaaattcca tattcgatga ttgaggtgaa tgggatagac       180
     acacaagaac aaatagcatt tgtatctgat tgttttaata ctcaattaat tgatttttta       240
     aattgtaata atattcatag tgaggcttct aaaataaata ataaagtagg atttggacct       300
     attgaggcag attttttatt tgcctttatc tcaaagcatc aacctaagca aatatttcaa       360
     attggatgtg gtgtttcaac tgctgtttgc cttaaggcag caaattatgc ttgctatgct       420
     cctgaaatta tttgtgttga accatatcca aataattatt tacgcgaaat tgagaggcaa       480
     gggagaatta cattgattaa tgaaaaggct caatcatatt gtcctatcaa tatcgaaaaa       540
     cttgatagtg atgttctttt ctttgttgat tctactcata ctcttggtcc ttctggtgaa       600
     gttagtcgta ttattctaga aatgctaccc agattaaaga aaggagcatg ggttcatttc       660
     catgatatta aatttcccta tgattatgat aggaatattc tagactcagc tctttttttt       720
     cagcatgaat cagttttact tcatgcattt cttgttggta ataataggtt taaaatttgt       780
     gcttcactgt caatgttgca ttattcatgt cctacagttc ttgctcaatt cttgactaaa       840
     tataagccag catctaatga tgaaggctta aactcctatg attctttaaa taagcaagaa       900
     caattccatt tccctagttc aacttacttg aaagtaatta cttaa                       945
//

If you have problems or comments...

PBIL Back to PBIL home page