(data stored in ACNUC27125 zone)

EMBL: CP000828.PE338

CP000828.PE338       Location/Qualifiers
FT   CDS_pept        complement(341056..342003)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0372"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25429"
FT                   /db_xref="InterPro:IPR008775"
FT                   /db_xref="UniProtKB/TrEMBL:B0C9Y9"
FT                   /protein_id="ABW25429.1"
FT                   /translation="MQISSNNKIRKFTLSQRKEIKEYFDEFGYVVIKNVLSHNIIDSFI
FT                   EELDSIKRNLLFVYFSQSTHVCMRPKLNQYGFIQESMKDASRLAFFSRFSLKIQECIYD
FT                   NCISQALTNLTDEKEHISWQNMFFDQSTGTIEHQDSWYLDTDPPGNLIGVWYALENIYE
FT                   DSGPFFVIPGSHKYGLIDRKKYSQHNDYLNAVTDVSNKLQAQKKIMSLQKGDILLWHSY
FT                   LIHGALLCEDSSKSRKSFTSHFYPKKLRAKNTEKRKLFSIYDHKNPKPTLNPNIYSAYK
FT                   YNDFFYNIIVYLLYSKNILTNIDRAWSMRREDYS"
     atgcaaatat caagcaataa taaaataaga aaatttacct taagtcagag aaaagaaata        60
     aaagagtatt ttgatgaatt tggatatgta gtaatcaaaa atgttcttag tcataatatt       120
     attgattcat ttattgaaga acttgattca ataaaacgaa atttattatt tgtgtatttt       180
     tcccagtcta cgcatgtatg tatgcgccct aaactaaatc aatatggttt tatccaagag       240
     tcaatgaaag atgcaagtcg tctagcattt tttagtaggt ttagtttaaa gatacaagaa       300
     tgtatttatg ataattgcat ttcacaagct ttgactaatt tgacagatga aaaagagcat       360
     atttcatggc aaaatatgtt ttttgaccaa tcaacaggta caattgaaca tcaagattct       420
     tggtatttag atacagatcc acctggaaat cttattggag tctggtatgc attagaaaat       480
     atttatgaag atagtgggcc tttctttgta atacctggct ctcataagta cggattaatt       540
     gatcgaaaaa aatattctca acataatgat tatttaaacg ctgtaactga cgtctcaaat       600
     aaattacaag cacaaaagaa aataatgagt ttgcagaaag gagatatact cctttggcat       660
     tcgtatctaa tccatggtgc tttattatgt gaggatagtt ctaagagtag aaagtcattt       720
     acttcgcatt tttatcctaa aaaactaaga gcaaagaata ctgaaaaaag aaaactattt       780
     tcaatatacg atcataaaaa cccaaagcca actttgaatc ctaacatata ctctgcttat       840
     aaatataatg atttttttta taatattata gtttatttgt tatattcaaa aaatattttg       900
     acgaatattg atcgagcttg gtcaatgagg cgcgaggatt atagttga                    948
//

If you have problems or comments...

PBIL Back to PBIL home page