(data stored in ACNUC5340 zone)

EMBL: CP000828.PE339

CP000828.PE339       Location/Qualifiers
FT   CDS_pept        342822..342956
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0374"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25430"
FT                   /db_xref="UniProtKB/TrEMBL:B0C9Z0"
FT                   /protein_id="ABW25430.1"
FT                   /translation="MLKKVTLTRYFKTGYICLILAITKSSLKNLQKEIILLKLELFSY"
     atgctaaaaa aagttacatt gactagatat tttaagactg gctatatctg tttgatttta        60
     gctattacta aaagttcctt aaaaaatctt cagaaagaaa ttattctact aaaattagaa       120
     ttatttagtt attga                                                        135
//

If you have problems or comments...

PBIL Back to PBIL home page