(data stored in ACNUC8465 zone)

EMBL: CP000828.PE342

CP000828.PE342       Location/Qualifiers
FT   CDS_pept        complement(344480..344644)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0376"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25433"
FT                   /db_xref="UniProtKB/TrEMBL:B0C9Z3"
FT                   /protein_id="ABW25433.1"
FT                   /translation="MVRNVVSKVLRIRKKTSEVFDLKKVLGTDIRGVYKLFNLKIISKW
FT                   FLSGDNFEQ"
     ttggttcgga atgttgtatc caaggtcctt agaataagaa aaaaaacctc tgaagtattt        60
     gatttaaaga aagtcttagg tactgatatt cggggtgtat ataaattatt caatctaaaa       120
     ataatttcta aatggttttt gagcggtgat aactttgagc agtaa                       165
//

If you have problems or comments...

PBIL Back to PBIL home page