(data stored in ACNUC27125 zone)

EMBL: CP000828.PE348

CP000828.PE348       Location/Qualifiers
FT   CDS_pept        complement(350975..351988)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0382"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25439"
FT                   /db_xref="UniProtKB/TrEMBL:B0C9Z9"
FT                   /protein_id="ABW25439.1"
FT                   /translation="MSKIWYFGDSNFNSNSYRRYLTLLRLGNSVSLFNPYKHLLPWMVK
FT                   ISWKISYDFFQGYIIKWLYVNLSNLPKPDLIWINSGEIFGKKCLKYLRGFGVPIILYNN
FT                   DDPTGSRDGLRFSTLLKNIHFYDLCVVMRSVNELEYKSFGAQKVLRVWMSYDELVHSTS
FT                   VGCQLNLSNISFLGTYRSGENRDQFLLDMICAGLDLEIWGNGWNKSPSYNDSKFNSHYY
FT                   GPAIGKKYADVIQNSAICLGFLSSTNRDTYTTRSVEIPASGGLLCAERTSEHQLLFEEG
FT                   KEAVFWSSISECIEVCKYLIQNPKLRETIREAGMKKVRKLGVGNEDVCRQILSIVS"
     atgagtaaaa tttggtattt tggagatagt aattttaatt caaattctta ccgacgatat        60
     cttactttac tcaggcttgg caattcagtg agtttattta atccttataa acacttgttg       120
     ccttggatgg taaagatttc ttggaaaatt agttatgatt tttttcaggg ttatataata       180
     aagtggctct atgttaactt atcaaatttg cctaaacctg atttaatttg gatcaattca       240
     ggagaaatat ttggaaaaaa atgtcttaaa tatttgcgtg gatttggcgt cccaattatt       300
     ttatataata acgatgatcc tactgggtct cgtgatggct tgcgtttttc aactttattg       360
     aaaaatattc atttttatga tctatgtgtt gtgatgcgta gtgttaatga acttgaatat       420
     aaatcatttg gtgctcaaaa ggtcttaaga gtatggatga gttatgatga gctagttcat       480
     tctacatctg taggttgtca attgaattta tctaacattt cttttttagg aacatatcga       540
     tctggagaaa accgagatca atttcttctt gatatgatct gtgctggcct tgatttagaa       600
     atttggggaa atggttggaa taaaagcccc agttataatg atagtaaatt taatagtcat       660
     tactatggtc cagcgattgg gaaaaaatat gcagatgtta ttcaaaactc tgcaatctgc       720
     ttaggcttcc tctcctcaac taatcgcgat acatatacaa caagatctgt agaaatacct       780
     gcttctggtg gattgctctg tgctgagaga accagtgaac atcagctctt atttgaagaa       840
     ggaaaagaag ctgtattttg gtcttcgatt tctgaatgta ttgaagtttg taaatatctt       900
     attcagaatc ctaagttgcg agaaacgatt agagaagctg gcatgaaaaa agttaggaaa       960
     ctaggggttg gcaatgagga tgtttgtcgc caaatcttat ctatagtgtc atga            1014
//

If you have problems or comments...

PBIL Back to PBIL home page