(data stored in ACNUC5340 zone)

EMBL: CP000828.PE350

CP000828.PE350       Location/Qualifiers
FT   CDS_pept        complement(353574..354740)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0384"
FT                   /product="glycosyl transferase, group 1 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25441"
FT                   /db_xref="GOA:B0CA01"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:B0CA01"
FT                   /protein_id="ABW25441.1"
FT                   /translation="MSISDFSIVQTTIGRFHHFHLARQLERFNLLSAIFTGYPLSKLRD
FT                   ETGIPIEKIHSFPWVQMPYMARGRIKLDRWNWLNREWAWQAHQTLDLYVSKHVKEFTTL
FT                   IALSGSGLVSGLKAQRLGGYYICDRGSSHIRYQDEILREEHTRWNVPYKGIDPRVIDKE
FT                   EAEYESANYITVPSEFVRQSFIEQRVSPDKVRKISYGARLDRFHPISKPKPDEFRILFV
FT                   GSVSFRKGFLDLLQAFNDFKHPNKKLVVIGSVSSNIIPFIEKYSIDQVTFIGKIPNKEL
FT                   PRYYSESHVFVLPSIEEGLAMVMGEALACGCPVIATENAGVSDLLQDGREGFIVPIRQP
FT                   QAITDKLQLLSDCPDLREKLSKNALKRVKQLGGWDCYGDQWFKFLQTF"
     atgagcatat ctgattttag tattgttcag actacaattg ggcgatttca tcatttccat        60
     ttggcccggc aattggagcg ttttaattta ttatcagcta tttttacagg ttatcctctt       120
     tctaagttac gcgatgagac tggaatacca attgaaaaaa tacatagttt tccctgggtg       180
     caaatgcctt atatggctag gggacgaata aaacttgatc ggtggaactg gttaaatcgt       240
     gagtgggctt ggcaagccca tcaaactttg gacctttatg tttcaaaaca tgtcaaggaa       300
     ttcactacct taattgcttt atctggttct ggcttagttt ctggcctcaa agcccaacga       360
     ttaggaggtt attatatctg cgatcgcggt tcttcacata tccgttatca ggatgagatt       420
     ttgagagaag agcatacaag atggaatgta ccttataagg gaattgatcc aagagttatt       480
     gataaagaag aggcagaata tgaatcagca aactatatca ctgtgccttc agaatttgtg       540
     cgtcaaagtt ttatagaaca aagggtatcc cctgataaag tacgtaaaat atcctatggt       600
     gctcgacttg accgatttca ccctatttca aaaccaaaac cagatgaatt ccgtattcta       660
     ttcgtaggca gtgtgagttt tcgaaaaggt ttccttgatt tactacaagc ctttaatgat       720
     ttcaagcatc ctaataaaaa gttagtagtc attggatcag ttagttcgaa tattattcca       780
     ttcatagaaa aatattctat agatcaggtt acatttatag gaaaaatacc taataaagaa       840
     ctacctcgct attatagtga atctcatgtt ttcgttttac ccagcattga agaaggttta       900
     gctatggtca tgggggaagc attggcatgt ggttgcccag tgattgctac agaaaatgct       960
     ggagtcagcg atttactcca agatggccga gaaggtttta tcgttccgat tcgacaaccc      1020
     caggcaatta ccgataagct ccaattatta tcagattgcc cagacctacg ggaaaaatta      1080
     tccaaaaatg ctcttaaacg agttaaacag cttggaggtt gggattgtta tggcgatcaa      1140
     tggtttaagt ttttacaaac attctag                                          1167
//

If you have problems or comments...

PBIL Back to PBIL home page