(data stored in ACNUC27125 zone)

EMBL: CP000828.PE351

CP000828.PE351       Location/Qualifiers
FT   CDS_pept        complement(354781..355623)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0385"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25442"
FT                   /db_xref="GOA:B0CA02"
FT                   /db_xref="InterPro:IPR005331"
FT                   /db_xref="UniProtKB/TrEMBL:B0CA02"
FT                   /protein_id="ABW25442.1"
FT                   /translation="MAISEELNLVFIHIPKNAGKSVTSALNIFDLSNKRNNKLVQRNLI
FT                   GNVGRFFSQRSNRHSLNFSPKMGMYDYPLYMGHCTLQEMVSLRLSSIEFFKNADKFAVI
FT                   RNPFSRTLSLFHHWCKKNYRDKSEASILFDKFITEIENIRSYGEIGSDTLLGKCRHSMI
FT                   SHFNLQVEFLDTNFSGISSDYILQYEYLNDALKSFIQYITLPVDQFAWETYPNSLSKDS
FT                   FWYEILNSNEIVLKINRIFSRDFYELGYQTDNFSFENSKSCFPKGYEEISSGFFKRVS"
     atggctataa gtgaagaatt aaaccttgta tttatccata ttcctaaaaa cgcaggtaaa        60
     agtgtaacta gtgctttaaa tatttttgat ttatcaaaca agagaaataa taagctagtc       120
     caacgtaatc ttatcggcaa cgttgggaga tttttctctc aacgttcaaa tcgccatagt       180
     ctgaactttt ctccgaaaat gggtatgtat gactatccac tttatatggg ccattgcacc       240
     ttacaagaga tggtttcatt acgattgagt tcaattgaat tctttaaaaa tgcagataag       300
     tttgctgtaa ttagaaaccc tttttctaga actttatcac tttttcatca ttggtgtaag       360
     aaaaactata gggataaaag cgaggcatct attttatttg acaagtttat tactgagata       420
     gaaaatataa ggagctatgg agaaattgga agtgatactc ttttgggaaa atgtagacat       480
     agcatgatat cgcattttaa cttgcaagta gaatttctag atactaattt ttcaggaatt       540
     tcatctgact atatcttgca gtatgaatac ttaaatgatg ctctcaagag ttttattcaa       600
     tatattacac ttcctgttga tcaatttgct tgggaaactt atcctaattc actatctaaa       660
     gattcattct ggtatgaaat tctaaatagc aatgaaattg ttcttaaaat aaatagaatc       720
     ttttctagag acttttatga attaggctat cagactgata atttttcttt tgaaaattca       780
     aaatcatgtt ttccaaaagg gtatgaagaa atttcgtcag gcttttttaa gagagtttct       840
     tga                                                                     843
//

If you have problems or comments...

PBIL Back to PBIL home page