(data stored in ACNUC8465 zone)

EMBL: CP000828.PE355

CP000828.PE355       Location/Qualifiers
FT   CDS_pept        complement(360770..361654)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0389"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25446"
FT                   /db_xref="UniProtKB/TrEMBL:B0CA06"
FT                   /protein_id="ABW25446.1"
FT                   /translation="MPVYSVFGFCIQSDIYLPELVEADGRPDVVLKIDKLATYHHKHDA
FT                   GFCFRGRISNILRFLVYKGQEIVIEPFANVEIGLVRSILYGPIFTILLRQQGQLVLHGS
FT                   CVVLQNAATAFLGHSKAGKSTLAEAFHHHDCSVITDDVLAIQFASDFPTVLPSIPRIKL
FT                   WPDSAIAMGHQPDKLKSIYGYSSKKVHLLPQKEFPALPLSSIYVLNQGKEFSIIKLNPQ
FT                   QAFLEILKNSRATKELIHPQFVKLHFEQCTALLKKVPVYLLTRPLDLNSISKTVEKIQI
FT                   HEQGYHRRLMPLC"
     atgccagtct attcggtgtt tggtttctgt attcagtcag atatttactt gcctgagctt        60
     gttgaagcag atggacgccc agatgtagta ctaaagattg ataaattagc aacataccat       120
     cataagcatg atgctggctt ctgttttcga ggtagaatat cgaacattct tcgtttcctt       180
     gtgtataaag gacaagaaat agtcattgag ccttttgcta atgtcgaaat cggtttagtt       240
     cgatccatac tctatgggcc aatttttact attcttcttc gccaacaagg tcagcttgtt       300
     ttgcatggaa gctgtgttgt attacaaaat gctgctactg catttttagg tcattcgaag       360
     gctggcaagt ccactttggc agaagcattc catcatcatg attgctcggt aattactgac       420
     gatgtattag ccattcaatt tgcttccgat tttccaactg ttctacccag catcccccgg       480
     atcaagttat ggcctgattc cgctattgca atgggacatc agcctgataa gcttaaatca       540
     atatacggct actcttctaa gaaggttcac cttcttcctc aaaaagaatt tcctgcccta       600
     cccttatcaa gtatctatgt ccttaatcaa gggaaggaat tttctattat caagcttaat       660
     ccacagcaag catttctaga gattttaaaa aattctcgag caactaagga actaattcat       720
     cctcagtttg tgaagcttca ctttgagcaa tgtacggccc tgcttaagaa ggtaccagtc       780
     tatttactta caagacctct cgatctaaat tcaatatcaa aaaccgttga gaaaatccag       840
     attcatgaac aaggatatca tcgaagatta atgcctcttt gttag                       885
//

If you have problems or comments...

PBIL Back to PBIL home page