(data stored in ACNUC27125 zone)

EMBL: CP000828.PE357

CP000828.PE357       Location/Qualifiers
FT   CDS_pept        complement(362101..364233)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0391"
FT                   /product="lipopolysaccharide biosynthesis protein,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25448"
FT                   /db_xref="GOA:B0CA08"
FT                   /db_xref="InterPro:IPR005702"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B0CA08"
FT                   /protein_id="ABW25448.1"
FT                   /translation="MSNYWLMLKRRGLPAGFTFLTVLSLALLQAFQEKPIYEAVGQLKF
FT                   EESQRSSKLIGLDSAVDDESRQQSSLRWQRSLDTEILTMKSPRRLSMLALAIESQGLFS
FT                   RPSVEQIKSGLDISQFDETNVVQIRFKSYNREFPKNIVNLLMQQYVDNTPKSKQASTQS
FT                   AISFIEKQLPQVKQRVNSAETALRKFKETYQIADLEIAKSANATNLSQLQTALDEIDRE
FT                   LVEVQTQQLSLQNMLKVNPQQAILGISTAHKNISTSLEEIDKDLAEAKSNFREDHPAVL
FT                   ELLERQAQLKQLLSQKIEKFAQSDAQLNFDSNQEDDLRSQLIQLDIRRNGLSKQQLKLR
FT                   QQLSSYRQQARNLPQLEQRQNELERTAKASASTYRNLLEQIQELKVTENQSPLTVSILE
FT                   SATDPEPSKTTFISAAMRGGLAGILLASGVVYVLERIDRKLKSKDEIRQVYPYRVLGEI
FT                   PLFDESEAESLKLPTLSDPASHLSEAYRMLQSSLKFHGLEHSPRVLMMTSAINQEGKST
FT                   TCANLAVSLAQMNHRVLLIDADIRLASQHQIWELGNQEGLTHILLNKHFNYHQELPTHK
FT                   VADNLEIITAGRISSNPLPMLESEQFANFVQVQIEHYDYILIDAPPLVSVADPLIIGKV
FT                   VDGILLVARPGHLEREYAQKAHELLIHSNLSVLGTVINGILNKNELYSYYSRYGHNSNQ
FT                   EKTAIKRNLLKQVISK"
     ttgtcaaatt attggttgat gctgaagaga cgaggtttgc ctgcgggatt tacttttttg        60
     accgttttat cacttgcgtt gctgcaagct tttcaagaga aacctattta tgaagcggtt       120
     gggcaactga aatttgagga aagtcaacgg agctcaaaat taattggtct agattctgca       180
     gtcgatgatg aaagtcggca acaatctagt ttacgttggc aaaggtcact agacactgaa       240
     atccttacta tgaaaagtcc cagacggctt agtatgcttg ctttggccat tgaaagtcaa       300
     ggtctgttct cccggcctag cgtagagcaa attaaatctg ggttagatat ttctcaattt       360
     gatgagacta acgtagtcca gattcgattc aaaagttata atcgcgaatt tcccaaaaat       420
     attgttaact tgctgatgca gcaatatgtt gacaatactc ctaagtcgaa acaagcatct       480
     acccaatcag caatttcgtt tattgaaaaa caactgcctc aagttaagca gcgcgttaac       540
     tctgcagaaa cagcattgcg caaatttaag gaaacctatc agattgccga tctagagatt       600
     gctaaatctg ctaacgcaac taacctttct caactccaga cagccctaga tgaaatcgat       660
     agggagttag tagaggtgca aactcagcag ctaagtctgc aaaatatgct aaaagtgaat       720
     ccacagcaag caatattagg aatttcaact gcccacaaga atatatcaac tagccttgag       780
     gagatagaca aagacctagc ggaagcaaaa tcaaacttta gagaagatca tcccgctgtt       840
     ttggaattat tggagaggca ggctcaatta aagcaattgc taagccaaaa aatagaaaaa       900
     tttgctcagt ctgatgccca gttaaatttt gactcgaatc aagaagatga tttgcgctcc       960
     caacttatcc agctggatat taggcgtaat gggttgtcta agcaacagtt gaaattgaga      1020
     caacaattgt ctagttatcg tcagcaagca cgaaatttgc ctcaattaga acaacgtcag      1080
     aatgagctag agagaactgc aaaagcatct gcttctacct atcgaaattt gcttgaacaa      1140
     attcaagagt tgaaagttac tgaaaatcag tctcccttga ctgtgagtat tttagaaagt      1200
     gcgactgatc cggaaccatc taaaaccact tttatctcag cagcgatgcg aggcggatta      1260
     gcaggtatac ttttggcatc aggggtagtc tatgttctag aacgaataga tcgaaagcta      1320
     aaatccaaag atgaaattag acaagtttac ccttatcgag tgttaggtga aattcctttg      1380
     tttgacgaaa gtgaagcgga atccctaaaa ctaccaactt tgtccgaccc tgcttctcac      1440
     ttaagtgaag cttacagaat gctccaatct agcttgaaat tccatggttt ggaacattct      1500
     cctagagtat taatgatgac tagtgccata aaccaagagg gtaaaagtac gacttgtgct      1560
     aatttagcgg tttctttggc tcaaatgaac catcgagttt tattgattga tgctgatatt      1620
     cgcttagcct ctcaacatca aatctgggaa ttagggaatc aagaaggctt aacgcatata      1680
     ttattgaata aacattttaa ttatcatcaa gaattgccaa ctcataaggt tgcagataat      1740
     ttagagatta ttactgcagg aaggatttca tccaatccac taccgatgtt ggaatctgaa      1800
     caatttgcta attttgtaca ggttcaaata gaacattatg actacatcct tattgatgca      1860
     ccacctctgg tttctgttgc tgatcccctt attattggca aagtagttga tggcatccta      1920
     ttagttgctc gcccaggtca tttagagcgt gagtatgctc agaaagccca tgagctattg      1980
     attcattcaa atttgagtgt tttgggaacg gttattaacg gaattcttaa taagaatgag      2040
     ctttattctt attattcgcg atatggtcac aactctaatc aagagaagac tgcaataaag      2100
     agaaatttat taaagcaagt tatttcaaaa taa                                   2133
//

If you have problems or comments...

PBIL Back to PBIL home page