(data stored in ACNUC27125 zone)

EMBL: CP000828.PE359

CP000828.PE359       Location/Qualifiers
FT   CDS_pept        366086..367057
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0393"
FT                   /product="NAD-dependent epimerase/dehydratase family
FT                   protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25450"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B0CAW0"
FT                   /protein_id="ABW25450.1"
FT                   /translation="MRVLVTGAAGFIGYHLSQRLLLDRAQVFGIDNLNNYYAVDLKKSR
FT                   LAQLEPNQNFQFQCLDLSDRNGMETLFESNTFDGVIHLAAQAGVRYSLDNPHAYVDSNL
FT                   VGFLHILEGCRQSNISHLVYASSSSVYGANKKVPFSVEDNVDHPVSLYAATKKSNELMA
FT                   HSYSHLYQIPITGLRFFTVYGPWGRPDMAYFKFVDAIANNKSIDVYNHGKMQRDFTYID
FT                   DVVEGIVRVLHQPPNPDTTTPPYKLYNIGNNQPVTLMRFIEVIETAMGKTADKNFLPMQ
FT                   PGDVPATYADVDALMNDVGFQPKTPIEDGIQKFVTWYRSYYQ"
     atgcgagttc tggttacagg tgccgccggt tttattggtt accatctatc tcaacgcctt        60
     ttgctagata gagcacaggt atttggaatc gacaatctca ataactatta tgctgtcgat       120
     ctcaaaaaat cacgactcgc ccaattagag cccaatcaga atttccagtt ccaatgtcta       180
     gatctcagcg atcgcaacgg tatggaaacc ctgtttgaga gcaatacctt tgatggtgta       240
     attcatttag ctgctcaggc tggggttcgc tattctctag acaaccctca tgcctatgta       300
     gacagtaatc tggtgggctt ccttcatatc cttgagggct gtcgccaaag caacatatct       360
     catctggttt atgcgtcctc tagctcagtc tatggtgcca ataaaaaagt ccctttttcc       420
     gtagaagata atgtggacca tcccgtttct ttatatgccg ccaccaagaa atcgaatgag       480
     ttaatggccc attcctatag ccatctatat caaataccga tcaccggact gcgatttttt       540
     acggtatatg gtccctgggg acggccagat atggcctatt tcaagtttgt ggatgccata       600
     gcaaataaca aatccatcga tgtctacaac cacggaaaaa tgcagcgaga ttttacctat       660
     atcgatgatg tcgtcgaagg tattgtccga gttctccatc agcctccaaa cccagacacc       720
     acaacccctc cctacaagct ctacaacatt ggcaataacc aacccgtaac cctgatgcgc       780
     tttatcgaag taattgaaac cgccatgggt aaaacggcgg acaagaactt tttacccatg       840
     caaccggggg atgtcccagc aacctatgca gacgtagatg ccttaatgaa tgacgtgggc       900
     tttcaaccca aaaccccaat tgaagatggg attcaaaaat ttgtaacttg gtatcgcagc       960
     tattatcaat ag                                                           972
//

If you have problems or comments...

PBIL Back to PBIL home page