(data stored in ACNUC8465 zone)

EMBL: CP000828.PE361

CP000828.PE361       Location/Qualifiers
FT   CDS_pept        complement(367810..369990)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0395"
FT                   /product="sensory transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25452"
FT                   /db_xref="GOA:B0CAW2"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B0CAW2"
FT                   /protein_id="ABW25452.1"
FT                   /translation="MPLRFYPFTQLFQARLSRRIELWVFLSIIAIEAVILIPSVYRREA
FT                   ELLKHLTEISAAKATGLLANEENEITDQTVLDKLVVIEENPAVTGGILFRTDGTKVGEF
FT                   GEQPELTFEQATRRSEETYLNRALQRYDATWPMPLLDKYVLIVRHDASNVQNELNQFIW
FT                   RIIGLVVIISLFVSLATMIVLQSFVIAPILQLRKDLLQAGTFLATPPGSSPPEFESTQN
FT                   PPDDELGDVIQTFEQMFNQIRDAIASRQQAESDLRLSEEKFSKAFRASPNPITMSTLED
FT                   GCLVEVNDSFLDLFGLTASEVLGRTSLELDLWADPADRMQMIQAILKDGIIRNYEYRLC
FT                   DRNGKEKTVLYSSEQLKVNDQDCILSVINDITERKEAEIALEASEERFRMLVDQAVDAI
FT                   YVVNEQGQFVDVNQQACANLGYTRDELLGCRVPDIQKSLSDDDFVNLWQRLLPKDPLTF
FT                   IGTHQRKDGSQFPVEVRLGLFEAGEEQLLLALARDITERRQAEKDRERLAEIGELAAMI
FT                   VHEVRNPLTTVLMGLNSFQRMDLPDRAKLRLQLALEESERLQRLLNEILLYAKQQKLDT
FT                   TAVELNQLFADMLPTLQEMPSAADRPIQLMPADESAWVDADIDKLKQVFINLVSNACEA
FT                   VPEGEPIIWQLQIVALQDQVKIEVNNGGDPIPADVLPQLTKPFFTTKSSGNGLGLAITK
FT                   RIVETHGGELVIQSSAASGTTVTVSLPTVNSP"
     gtgcccttgc ggttttatcc ttttacccaa ctttttcaag cccgactctc gcgccgaatc        60
     gagctatggg tatttctgag cattattgca attgaagccg tgattcttat cccttccgtt       120
     taccgacgtg aagctgagct acttaagcac ctgacagaga tctcagctgc taaagccaca       180
     gggttactgg caaacgagga aaatgaaatc accgatcaaa cggtcctaga caaacttgta       240
     gtgatcgagg aaaatccagc cgtcaccggt gggattctat ttcggactga tggcaccaaa       300
     gttggggagt ttggtgaaca acctgagctt acctttgagc aggctactcg gcgttccgaa       360
     gaaacatatc tcaatcgagc cctacaacga tacgatgcca cctggcccat gcccttgctc       420
     gataaatatg tgctaattgt tcgccatgat gctagcaatg tccaaaacga actcaatcag       480
     tttatttggc ggatcattgg cctggtggtc attatttcct tgtttgtgtc cttagcaacc       540
     atgattgttt tgcagtcctt tgtgattgcg cccattttgc agctgcggaa agatttgctt       600
     caggcgggga ccttcttagc gacaccaccc ggcagttcac cgccagagtt tgagtccacc       660
     cagaatccac cggatgatga attgggggat gtgattcaaa ccttcgagca gatgtttaat       720
     cagattcgcg atgcgatcgc atcccggcag caggctgaat ctgacctcag actatcagaa       780
     gagaaatttt ccaaagcatt ccgagctagc cccaacccca tcaccatgag tactcttgag       840
     gatggttgtc tggttgaagt gaatgacagc tttttggatt tatttgggtt gaccgcttca       900
     gaggtattag gtcggaccag tttagaactg gatctatggg ccgatccagc ggatcgaatg       960
     cagatgattc aggccattct caaggatggc attattcgaa attatgagta tcgattgtgc      1020
     gatcgcaacg gcaaagaaaa gacggttctc tattcttccg aacagctgaa ggtcaatgac      1080
     caggactgca tcctctccgt cattaatgac attaccgaac gcaaagaggc tgaaattgcc      1140
     ctagaggcca gcgaagagcg atttcggatg ttggtggacc aagcggtcga tgccatttat      1200
     gtggttaatg agcaggggca gtttgtggat gtgaaccagc aagcctgtgc caacttgggg      1260
     tatacccggg atgaattatt agggtgtcgt gtaccagata ttcaaaaaag tttgtcagac      1320
     gacgattttg tgaatttatg gcaacgactg ctgccgaaag atcctctcac ctttattggc      1380
     actcatcagc gcaaagacgg cagtcagttt cccgtcgaag ttcggttagg gttatttgaa      1440
     gcgggagaag aacagttact cctagcccta gcgcgagata ttacagagcg acgacaagcg      1500
     gaaaaggatc gagagcgact ggcggaaatt ggggaactgg ccgccatgat tgtccatgaa      1560
     gtccgtaatc ctctaacaac agtcttgatg ggattgaatt cgttccagcg catggactta      1620
     cccgaccggg ctaaactacg gttgcagttg gccttagagg agtcagaacg gttgcaacga      1680
     ctcctgaatg aaattttgct ctatgccaaa cagcaaaagt tagacacaac agccgttgag      1740
     ctgaatcagt tgtttgccga tatgctgccg accttacaag aaatgcccag tgcagcagat      1800
     cgcccgattc agctgatgcc tgctgatgag tcggcatggg tagacgctga tatcgataaa      1860
     ctgaagcaag tctttatcaa tttagttagc aatgcctgtg aagcggttcc cgaaggtgaa      1920
     cccattattt ggcagcttca gattgtagcg ctacaagatc aagtcaagat tgaagtcaat      1980
     aatgggggag atccgattcc cgcagatgtg cttccccaat taacgaagcc gttttttacc      2040
     accaagtcat ctggaaatgg gttgggactg gcaattacca agcggattgt ggagacccat      2100
     ggtggcgaat tagtaatcca atcttcagct gctagtggca ctaccgttac cgtgtcttta      2160
     ccaacagtta attctcccta g                                                2181
//

If you have problems or comments...

PBIL Back to PBIL home page