(data stored in ACNUC27125 zone)

EMBL: CP000828.PE362

CP000828.PE362       Location/Qualifiers
FT   CDS_pept        complement(370132..370599)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0396"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25453"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:B0CAW3"
FT                   /protein_id="ABW25453.1"
FT                   /translation="MIFVLDSSPLSQLTNPNQEHVILSQWLKKAVQIGHIIAIPEIAYY
FT                   EVRRELIRLDRPKSVQRLDEFCQLDGSLNLAYIPISTEIMRKASQLWAWARQTGQQTAS
FT                   NEALDADVILAATSIVIAQENSLPSMVVTKNVRHIARYTPAEDWEDISLNP"
     atgatctttg tcttggacag tagtccattg agtcagctta caaatcccaa tcaagagcat        60
     gtgatattaa gccagtggct aaaaaaggca gttcaaatcg gtcatatcat tgccattcca       120
     gaaattgcct attatgaagt tcgccgcgaa ctaataaggt tagataggcc gaaaagtgtg       180
     cagcgcttag atgagttttg tcaattggat ggatctctca acttggctta catcccgatc       240
     tcaacagaaa taatgaggaa agcaagtcag ctgtgggctt gggctagaca aactggacaa       300
     caaacagcaa gtaatgaagc attagatgca gatgtcatat tggctgctac atctattgtg       360
     attgctcaag agaactcact accctccatg gttgttacca aaaatgttag gcacattgcc       420
     agatacacgc cagcagaaga ttgggaagac atttctctaa atccttag                    468
//

If you have problems or comments...

PBIL Back to PBIL home page