(data stored in ACNUC8465 zone)

EMBL: CP000828.PE363

CP000828.PE363       Location/Qualifiers
FT   CDS_pept        complement(370596..370898)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0397"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25454"
FT                   /db_xref="UniProtKB/TrEMBL:B0CAW4"
FT                   /protein_id="ABW25454.1"
FT                   /translation="MGERAQAYSQITNPEEHAKAIVEITSCLKSFRDRYAEFLSSEDLQ
FT                   RLKVYLQAMQEIIDSNEKVKATISALDDLFASWHERFDEQEMYESSALVAEIFGS"
     atgggagagc gtgctcaagc atattctcaa atcactaatc ctgaagaaca tgcaaaagct        60
     atagtagaaa tcactagttg cttaaaaagc tttagagaca gatatgctga atttttatcc       120
     tcagaagatc ttcagagatt aaaggtatat cttcaagcaa tgcaggaaat aatcgatagc       180
     aatgagaaag ttaaggctac aatctcagct ctagatgatt tgtttgcttc atggcacgag       240
     cgattcgatg agcaagagat gtatgaatca tcagctttgg ttgcagaaat atttggttca       300
     tga                                                                     303
//

If you have problems or comments...

PBIL Back to PBIL home page