(data stored in ACNUC27125 zone)

EMBL: CP000828.PE367

CP000828.PE367       Location/Qualifiers
FT   CDS_pept        complement(373470..374531)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0401"
FT                   /product="acyl-CoA dehydrogenase family protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25458"
FT                   /db_xref="GOA:B0CAW8"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:B0CAW8"
FT                   /protein_id="ABW25458.1"
FT                   /translation="MTFLEQTEAFLRGVIAPQAMQIDQHSESLFQALKALGNQGLLGLR
FT                   VPQEWGGQDLDELTFRQFQEQVSRYSGALAFLQTQHQSAASLIARSPNTGLQEKYLPHL
FT                   SSGKVSVGIGFSHLRRQNPPPVQAIETDTGYEITGEVPWVTGYGCFKHFIVGAQLADGQ
FT                   AVFGLVPLATVSQAGGIITCSDPLPLAAMGATQTVKVRLNRWQLPQDAVVVIRPPDWIH
FT                   TNDQKNSLHHSFFALGCAQAGLDILSNEKLPDFVDPARQLLDQELQSCRLAIYQEQQTP
FT                   ELTVPKRLQLRAWAIELANRCAHAAVISGRGGANLMDHPAQRVYREALAFSVFGQTTDV
FT                   MEVSLARLVRSSS"
     atgacgtttc ttgagcagac tgaggcattt ttgcgaggag tgattgcgcc gcaagcaatg        60
     cagattgacc agcattctga gtctttattt caggcgctga aggcgttggg aaatcaggga       120
     ctgctggggc tgcgtgttcc ccaggaatgg ggtggacaag atcttgatga gctgaccttt       180
     cgccagtttc aagaacaggt cagtcgctat tcgggggcat tggcattttt acaaacccaa       240
     catcaaagtg cagcctcgct cattgctcgt agtcccaata cggggctgca ggaaaaatat       300
     cttccccact tgagtagtgg caaggtgtcg gttgggattg gtttttctca tctgcgccgc       360
     cagaatccac ccccagtgca ggctattgaa acggatacgg gttatgaaat tacgggtgaa       420
     gttccttggg tcactggata tggttgtttt aagcacttta ttgttggagc ccaactggcg       480
     gatggacaag cggtgtttgg tttagtgccc ttggcaacag tttctcaagc tgggggcata       540
     atcacttgca gcgatccact acctttggcg gccatggggg ctacccagac ggtgaaggtt       600
     cgattgaacc gttggcaact tccgcaggat gcagttgtgg tgatacgtcc accggactgg       660
     attcatacca atgatcagaa aaatagcctg caccatagct tttttgcttt gggatgtgct       720
     caggctggac tggatattct ttctaatgag aagctaccag actttgtaga tccggctcga       780
     caattattgg atcaggagtt acagtcgtgc cgattggcaa tttaccagga gcagcaaacc       840
     cctgagttaa cggtgcccaa acgtctacag ctgagagcct gggcgattga attggcgaat       900
     cgctgtgccc atgcggctgt gattagtggg cggggtggag ccaatttgat ggaccatccc       960
     gcccaacggg tttatcggga agcgttagct ttttcggtat ttgggcaaac gacggatgtg      1020
     atggaagtgt cattggcccg gttggttcgc tcaagctcct ga                         1062
//

If you have problems or comments...

PBIL Back to PBIL home page