(data stored in ACNUC27125 zone)

EMBL: CP000828.PE373

CP000828.PE373       Location/Qualifiers
FT   CDS_pept        complement(380757..382991)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0407"
FT                   /product="lipopolysaccharide biosynthesis protein,
FT                   putative"
FT                   /note="Member of chain length determinant protein domain
FT                   (on N terminal), PF02706, and COG3206, uncharacterized
FT                   proteins involved in exopolysaccharide biosynthesis."
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25464"
FT                   /db_xref="GOA:B0CAX4"
FT                   /db_xref="InterPro:IPR003856"
FT                   /db_xref="InterPro:IPR005702"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032807"
FT                   /db_xref="InterPro:IPR033756"
FT                   /db_xref="UniProtKB/TrEMBL:B0CAX4"
FT                   /protein_id="ABW25464.1"
FT                   /translation="MPMSNEYSHESIDVRNYFRILRRRWIPATAVFGSVFVLTALATFL
FT                   QKPVYEAEGKLLLKKQGGATIADLEIGGLGGLEALSSKSSPVQTEAEIIRSEPILRQTI
FT                   TALKLVDDEDQPLETKDFIEALTVFNVRDTDVLKVTYKSIDPKESADVVNRLMDDYLKN
FT                   NIETNRAEAASARVFIEKQVPEVAAKLKNLDLSLRRFKETNGIIALEEEAKVSVEVEGN
FT                   FYQEAAKMQSLLINARAKSRALRNKLGLTPQQGEDINALSQSTVVQQALADYQENEREL
FT                   AEALKVFQPTHPTVLDLKEKRIALKGVLGEQTSQIIETKQPQPLRNLQAGESRQSLTDA
FT                   LVEAEVERLGLEKQVLSLAQTQAENKRRQGIIPKLEQQLIALERDRIVAQTTYEELLKA
FT                   LQQITISENQNIGNVRVIAAALEPKEPVSPRKAFNLAVGFFLGGLLGLGTALLLEALDT
FT                   SVKTVQEATGLFDYTVLGNIPLLKDAEKMTRKGLDRPTPDLVVRDSPRSSVSESYRMLQ
FT                   ANLKFLSSDHHVQVFVVTSSIPKEGKSTVVANLALALGELGHRVLVIDADMRRPSQHQV
FT                   WELPNALGLSNVLVEQKDWHEAIRPEDDQLDILTAGVTPPNPVPLIDSHHMAVLLEEFH
FT                   QAYDYVLIDSPPLAVAADALLLGKMTDGVLLVTRPGLVDTGSAQSAKDALERAGQKVLG
FT                   LVINGVIPENEPDSYYYYYAQDYYGENSGGKQSKAKKKKKKADVNAVERS"
     ttgccaatga gtaatgagta ttcacatgaa agcatcgatg tccgtaacta cttccgcata        60
     cttagacgtc gatggatacc tgctacggcc gtatttggtt cggtttttgt tctgactgca       120
     ttggcaacat ttttgcaaaa gcctgtttat gaagcagaag gtaagctttt gttgaagaaa       180
     caaggcggtg caacaattgc tgacctggaa attggtgggc tggggggctt agaagccttg       240
     tctagtaaga gtagtccggt tcaaacggaa gcagagatta ttcgttcaga gccaatttta       300
     agacaaacca ttactgcact gaagctagtc gatgatgagg atcaacccct agaaaccaag       360
     gacttcatag aagccttgac tgtttttaac gttagagata ccgatgttct aaaggtcacc       420
     tacaaaagca ttgaccctaa ggagtccgct gatgttgtga atcggctgat ggatgattat       480
     ctcaagaaca atattgaaac gaaccgagca gaagcggcct ctgcaagggt gtttattgaa       540
     aaacaggttc cagaggtggc tgcaaaacta aaaaatctgg atctatcctt acggcggttt       600
     aaggagacga acggaattat tgctttagaa gaagaagcta aagtgtctgt ggaggttgaa       660
     ggcaactttt accaagaagc agctaagatg caaagtcttc ttatcaatgc cagggccaaa       720
     agtcgcgccc ttagaaataa attgggactg actcctcagc aaggagaaga catcaatgct       780
     ttgagccaat cgacggtggt tcaacaagcc cttgccgatt accaagagaa tgagcgagaa       840
     cttgctgaag ccttaaaagt atttcaacct acccacccca ccgttcttga tcttaaagaa       900
     aaaaggattg ctctgaaagg ggtgttaggg gaacaaacaa gccaaattat tgagacaaaa       960
     caaccccaac ctcttcgtaa tctgcaagca ggagaatccc ggcagtccct gacggatgct      1020
     ttggttgaag ctgaagttga gcgcttaggc ttggagaaac aagttctatc tctggcccaa      1080
     actcaagctg aaaacaaacg tcggcaaggc ataatcccta aattagagca gcaattaatt      1140
     gctctagaac gggataggat tgtcgctcaa accacttatg aagagttatt aaaggcgttg      1200
     cagcaaatta cgattagtga gaatcagaat attggtaatg tccgcgttat tgcagcagcc      1260
     ttagaaccca aagaaccggt ttctccccgc aaagctttta atctggctgt tggttttttc      1320
     cttggaggtt tgctaggact agggaccgca ttacttcttg aagccttaga tacttctgtt      1380
     aagacagtcc aagaagcaac aggactcttt gattacacag ttctaggaaa tattccatta      1440
     ctgaaagatg ctgaaaagat gacccgcaag ggattggatc gtcccacacc tgatttggtg      1500
     gttcgagatt ctcctcgctc ttccgtgagt gaatcctatc gtatgcttca ggctaatctt      1560
     aaatttctga gctcggatca tcatgtgcag gtttttgtgg tcaccagttc catccctaag      1620
     gaagggaagt caaccgttgt ggccaactta gctttagcat tgggtgaact ggggcatcga      1680
     gtattggtta tcgatgcaga tatgagacgc ccttctcaac accaggtttg ggagttgcca      1740
     aacgctttag gactgagcaa tgttttggta gaacaaaaag attggcatga agctatccgc      1800
     cctgaggatg atcagctgga tattttgacg gcaggggtta cacctcctaa tccagtgcct      1860
     ttaattgact cccatcacat ggctgtattg cttgaagaat ttcatcaagc ctatgattac      1920
     gtactgattg attctccacc gctagcggtt gctgccgatg ctcttctact cggtaaaatg      1980
     acggatggtg ttctcttagt aactcgtcca ggcttggtgg acactggctc tgctcaatct      2040
     gcgaaagatg cattggaacg tgctggccag aaggttttag gacttgtcat taatggtgtt      2100
     atacctgaaa acgagccaga tagttattat tattactatg ctcaagatta ttatggagag      2160
     aattccgggg gcaaacagtc gaaagccaag aaaaagaaga aaaaagctga tgttaatgcc      2220
     gtagagcgct cctaa                                                       2235
//

If you have problems or comments...

PBIL Back to PBIL home page