(data stored in ACNUC27125 zone)

EMBL: CP000828.PE379

CP000828.PE379       Location/Qualifiers
FT   CDS_pept        387409..388323
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0413"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25470"
FT                   /db_xref="GOA:B0CAY0"
FT                   /db_xref="InterPro:IPR003390"
FT                   /db_xref="InterPro:IPR014046"
FT                   /db_xref="InterPro:IPR034701"
FT                   /db_xref="InterPro:IPR036888"
FT                   /db_xref="UniProtKB/TrEMBL:B0CAY0"
FT                   /protein_id="ABW25470.1"
FT                   /translation="MDGVKEWLINHDWVQTFRSLIDISLALALTYMLLLVIAERRTLWM
FT                   VRGVVFLVLATVASKLLQFNYLNQLLTFLLIGSAVAMAVILQSEVRRFLEQLGRGELLK
FT                   MLRPAQQVTQNPDNIIDEIVDAIKELSQNRTGALLIIETRNIPIDERDFSVPGIKLSAE
FT                   ISRELIQTIFQTTTLLHDGAILIRGDRIVSAGVILPISEQTASRQLGTRHRAAMGITER
FT                   VDNCVCIVVSEETGSISLAEQGILRRPLTSSKLRELLADRLILSVDREVVTPSLRSLGR
FT                   KIRKQIFSLLSLIFPLLKSRKNI"
     atggacgggg ttaaggaatg gctgataaac catgactggg ttcagacctt tcgttcctta        60
     attgatatca gcctcgcttt agctttaacg tacatgctgc tcttagtcat tgctgagcgg       120
     cgaaccctat ggatggtaag aggtgtcgtt tttcttgttc tagcaaccgt tgctagcaaa       180
     ctattgcaat tcaattacct caaccaatta ctcactttct tactcattgg ctctgccgta       240
     gccatggccg tcatcctgca atcagaagtc cgacgatttc tggagcaatt gggaagaggc       300
     gaactgttga aaatgttacg tcccgcgcag caggtcaccc aaaatccaga taacatcatc       360
     gatgaaattg ttgatgcaat taaagaactc tcccaaaatc ggaccggcgc tttactcatc       420
     attgaaactc gaaatattcc gattgatgaa cgagactttt cagtaccagg aataaagtta       480
     agtgcagaaa tttctcggga gctcattcaa accatttttc aaacaactac cttgttgcac       540
     gatggtgcca tattgatccg aggggacagg atcgtttcag ctggcgttat tctacctatt       600
     tctgaacaaa ccgcttctcg ccaattaggc actcgccacc gtgcagcgat ggggatcaca       660
     gaacgggttg ataattgtgt ctgtatcgtc gtttctgaag agaccggctc catctcccta       720
     gctgaacaag gtatactgag acgcccttta actagcagta aattgagaga attgttggct       780
     gatcgattaa tcttatctgt ggatagagaa gttgtcaccc caagcttgag aagtttaggc       840
     aggaaaatca gaaaacaaat cttttctttg ctttctctca tattcccatt gctcaaatct       900
     cgcaagaata tatga                                                        915
//

If you have problems or comments...

PBIL Back to PBIL home page