(data stored in ACNUC27125 zone)

EMBL: CP000828.PE381

CP000828.PE381       Location/Qualifiers
FT   CDS_pept        complement(389243..389524)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0415"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25472"
FT                   /db_xref="InterPro:IPR021489"
FT                   /db_xref="UniProtKB/TrEMBL:B0CAY2"
FT                   /protein_id="ABW25472.1"
FT                   /translation="MTESCLPDPKTPLYNHPLPQIELWLHQLGCHQDSQDLHLWRVERD
FT                   QWKAEIWLDIEELSVVYVPAVSTERDIQRTFKYSLSRQDIEDAVFSGP"
     atgactgaat cctgtttacc agatcctaaa actccgctgt ataatcatcc tcttcctcaa        60
     attgagctat ggcttcacca gcttggatgc caccaagatt ctcaggattt gcatctttgg       120
     cgtgttgagc gtgatcagtg gaaggcagaa atatggctag atatcgagga gttgtctgtt       180
     gtatacgtgc cagctgtttc cactgaacgc gatattcaac gaaccttcaa gtactcttta       240
     agtcgccaag atattgagga tgcagtgttt tctggtcctt ag                          282
//

If you have problems or comments...

PBIL Back to PBIL home page