(data stored in ACNUC27125 zone)

EMBL: CP000828.PE382

CP000828.PE382       Location/Qualifiers
FT   CDS_pept        complement(389862..390305)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0416"
FT                   /product="DnaJ-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25473"
FT                   /db_xref="GOA:B0CAY3"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:B0CAY3"
FT                   /protein_id="ABW25473.1"
FT                   /translation="MSMDSNFYQLLDLSPGASSDEIHDAYRRKSKVYHPDTTALPKETA
FT                   IQKFQQLNDAYRVLSSPELRKSYDYRLGVSPAKYTSVQKVRSSDNPLASSQVQIQERPL
FT                   SSGELVALLILCITFLGCLILAVVLGFARGEMMFVGLATLYLI"
     atgtcgatgg attcaaattt ctaccagttg ctagatcttt ctcctggagc ttctagtgat        60
     gagatccatg atgcttatcg aagaaagagc aaggtttacc atcctgacac aacggcttta       120
     cccaaggaaa ctgcgatcca aaaatttcaa caacttaatg atgcatatag agttttgagt       180
     agtcctgaac taagaaaatc atatgattat cgtttaggtg tttcgcctgc caaatatacc       240
     tccgtgcaga aggtgcgcag ttcagataat ccattggcat cttcacaggt tcaaatccaa       300
     gaacgccctt tgtcttctgg cgagcttgtt gcattattaa ttttgtgtat aaccttctta       360
     gggtgtttaa tcttggctgt ggtgttgggt tttgcccgtg gagaaatgat gtttgtagga       420
     cttgctactc tttacctgat atga                                              444
//

If you have problems or comments...

PBIL Back to PBIL home page