(data stored in ACNUC27125 zone)

EMBL: CP000828.PE386

CP000828.PE386       Location/Qualifiers
FT   CDS_pept        complement(394994..395158)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0420"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25477"
FT                   /db_xref="UniProtKB/TrEMBL:B0CAY7"
FT                   /protein_id="ABW25477.1"
FT                   /translation="MANLDSKIADVKGNGILDTQEDCKNLKKCGHAENSLAIASTWQGS
FT                   LFSSLHIHG"
     ttggctaact tggactctaa aattgctgat gtcaagggaa atggaattct tgatacccag        60
     gaagattgta aaaacctcaa aaaatgtggg catgctgaga acagcctcgc cattgcctcg       120
     acttggcaag gaagtctatt ttcaagctta catatccacg gttag                       165
//

If you have problems or comments...

PBIL Back to PBIL home page