(data stored in ACNUC5340 zone)

EMBL: CP000828.PE394

CP000828.PE394       Location/Qualifiers
FT   CDS_pept        402662..403381
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0428"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25485"
FT                   /db_xref="GOA:B0CAZ5"
FT                   /db_xref="InterPro:IPR007621"
FT                   /db_xref="UniProtKB/TrEMBL:B0CAZ5"
FT                   /protein_id="ABW25485.1"
FT                   /translation="MKVQLNKLWDWKGQLQRWLIVGLLTLLVGLPLWSPPALATVVEDI
FT                   PNLSASQSTWLADKAELLSVVTERSVNKTLKQISRQTGTDVRVITIRGLNYGETADSFA
FT                   NTLFEQWFPTAEDQANQVLLVYDARTNAPAILVGQEAQKLLSEETAQSIAFDNLLIPIR
FT                   KGNYNEAFIGAGDRFAAVISGQEDPGPPEVEVTAFAESNFRTAEETNDTSSAILVVVLL
FT                   ILATAIPMLTYFYYQRS"
     atgaaagttc aactcaacaa actatgggat tggaagggac aactacagcg gtggttgatt        60
     gttggcctgc ttaccctcct ggtcggattg ccgctttggt ctcctccggc cttggcaacc       120
     gttgttgagg atatccccaa tctttccgca agtcagtcga cttggttagc cgataaggca       180
     gaacttctga gtgtcgttac tgagcgatcg gtgaataaaa cccttaaaca gatatcccgg       240
     cagacaggga cagacgttag ggtcattacc attcgaggtc ttaattatgg tgagaccgca       300
     gatagttttg cgaacacctt atttgaacag tggttcccta cagcagaaga ccaagcaaac       360
     caagtcttgc tagtttatga tgctcgcacc aatgcccctg cgattctagt gggccaagaa       420
     gcccagaaat tgctttctga agaaacggct caaagtatcg cctttgataa tctgctaatt       480
     ccgattcgta aagggaacta caacgaggcc tttattggag ctggggatcg atttgcagct       540
     gtgatcagtg ggcaagaaga tccgggtcca cctgaagttg aagtcaccgc ttttgctgaa       600
     agtaatttcc gtactgcaga agaaaccaat gacaccagct ccgccatact agtcgttgtt       660
     ttattaattc tggcaacagc cattccgatg ctgacctatt tctactatca gcgttcatag       720
//

If you have problems or comments...

PBIL Back to PBIL home page