(data stored in ACNUC5340 zone)

EMBL: CP000828.PE397

CP000828.PE397       Location/Qualifiers
FT   CDS_pept        complement(406325..406720)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0431"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25488"
FT                   /db_xref="UniProtKB/TrEMBL:B0CAZ8"
FT                   /protein_id="ABW25488.1"
FT                   /translation="MADLSRDIQACLQQILHQSEQMFDASVDMLDQTLSQIEQGVEEYV
FT                   EPIVKEIEQGLDEVLDPIIVDLIAFEHELEEMASPLTQRLYPLFDQQPACVGCRHYYGK
FT                   TYGETFLVCGMHPYGASTNSCPDWESC"
     atggctgatt tgtctaggga tatacaagca tgtctacagc agattcttca tcaatctgag        60
     cagatgtttg atgcttctgt agacatgctg gatcaaaccc tttcccagat tgagcaaggg       120
     gtggaggagt atgttgaacc aatagtgaaa gagattgaac agggactaga cgaggtgctt       180
     gatcccatta ttgtcgatct cattgcgttt gagcatgagc tggaagagat ggcttcaccc       240
     ttaacccaac ggctttatcc cctattcgat cagcagcctg cttgtgttgg ctgtcgccat       300
     tattatggca aaacctatgg agagaccttt ctagtgtgtg gcatgcatcc ttatggtgct       360
     tctaccaatt cctgtccaga ttgggagtct tgttaa                                 396
//

If you have problems or comments...

PBIL Back to PBIL home page