(data stored in ACNUC27125 zone)

EMBL: CP000828.PE4

CP000828.PE4         Location/Qualifiers
FT   CDS_pept        4171..6042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0006"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25095"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:B0C3W5"
FT                   /protein_id="ABW25095.1"
FT                   /translation="MDVYINQKRVRLRPQQAIGKGGEADVYRLNRTTAVKLFKPPSHPD
FT                   FEGMVEAQQGARERLALHQQKLRQFPQSLPERVISPQALVMNQNGQRILGYTMPLLTHA
FT                   EVLLRYCDRRRRVKDHCRRQVGDHRKFQQAVDTQAVVDLFLDLHETVSKLHFADVVIGD
FT                   FNDLNILVQGTQAFVIDADSFQFGSFPCSVFTARFVDPLLCDPQGTQPILCRPYCWESD
FT                   WYAFTVMLMQALLFVDPYGGVYKPSDPAQRLPQAARPLHRVTVFHPQVRYPKPALPCDH
FT                   LPKPLLDHFRQVFEQDWRGEFPRSLLENLRWHTCPSCGVEHARSACPSCVKSVGIPMPP
FT                   GAVQVTTVLQTNGVILAATLTAGQLQWLVWEEGQFKREDGTVVLTGDLSPEFDWHLQGQ
FT                   TTWIVQQGQVVELPTTERIAVDSYQGRPQFAVNDRHSYWFNQGQLMRDHAVMGEVLIGQ
FT                   TQFWVGPRFGLGFYRAGQLNGAFVFDADRSGINDRLSLSMEAGTVVAAHCTFSQSFGWL
FT                   FVTLQAQGVLQQRCWVIAPTGQVLAQAEVGEWAATASGPCPHWAVEEALFVATDEGIIR
FT                   AQVEQGQVIVQRRFPETEPFVQTGCQLLAAPQGLYTVGSQTIQLLQL"
     atggacgttt atatcaatca aaaacgagtt cgtctgcggc ctcagcaagc cattggtaag        60
     gggggagaag cggatgtgta tcgtctcaat cgaacaacgg cggtgaagct gtttaaaccg       120
     cccagtcatc cagattttga gggcatggtt gaggctcagc agggtgcacg ggaacggttg       180
     gcactgcatc agcaaaagct acggcagttc ccccagtctt tgcctgagcg tgtcatttcc       240
     ccccaagcgt tggtgatgaa tcaaaatgga cagcgcattt tgggctatac gatgccactg       300
     ctcacccatg cagaggtgct gttacggtat tgcgatcgcc gcaggcgggt caaggaccat       360
     tgcagaaggc aggtcggaga ccatcgcaaa ttccagcagg cggttgatac tcaggcggta       420
     gttgacctgt ttttagatct acacgagacc gtctccaagc tgcattttgc agatgtggta       480
     attggggatt ttaacgacct caatattttg gtccagggca cccaggcatt tgtgattgat       540
     gccgattcat tccagtttgg ttcgtttccc tgttcggtct ttacagcccg gtttgtcgat       600
     ccactgctgt gcgatccgca agggacacaa ccgatattat gtcgccccta ttgctgggaa       660
     tcggattggt acgcctttac ggtgatgttg atgcaggcac tgctgtttgt tgatccctat       720
     ggaggggttt ataaaccctc tgatccggct cagcgattac cacaggcggc gcgaccacta       780
     catcgggtga cggtgtttca tccgcaggtg cgctatccca agccagcttt accttgcgat       840
     cacttgccga aacccttgct ggatcatttt cgccaggtgt ttgagcagga ttggcggggg       900
     gagtttccgc gatctctatt ggaaaatttg cgctggcata cctgtccgtc ctgtggggtg       960
     gagcatgctc gctctgcttg tccaagctgt gtgaaatctg tggggatccc gatgccgcca      1020
     ggtgcggttc aggtgacaac ggtgctgcaa acgaatggag tgattttggc ggcgacgtta      1080
     acggcggggc agctacagtg gctggtctgg gaggaaggac agtttaagcg agaagacgga      1140
     acggtggtgc tcacgggtga tctcagtcct gagtttgact ggcatctcca gggtcaaacc      1200
     acctggattg tccagcaggg tcaagtggtg gaattgccaa ccacggagcg cattgcggtg      1260
     gatagctatc aaggtcgccc ccagtttgcg gtcaacgatc ggcatagtta ttggttcaac      1320
     cagggacagt tgatgcgaga ccatgccgta atgggggaag tattgatcgg acaaactcaa      1380
     ttttgggtgg ggcctcggtt tggtctgggc ttttatcgag ctggacaatt gaacggagcc      1440
     tttgtcttcg atgctgatcg ttcaggcatc aacgatcggc tgtctttgtc tatggaagcg      1500
     gggacagtgg tggcggccca ctgtacgttt agtcagtcct tcgggtggct ctttgtcacc      1560
     ctgcaggccc aaggggtgct gcaacaacgc tgttgggtga ttgcgccgac gggtcaggta      1620
     ctagcgcagg cggaggtagg ggaatgggcc gcaacggcat ccggcccttg tccccactgg      1680
     gcggtggaag aggcgctgtt cgtggccacg gatgagggca ttatccgggc gcaggtggag      1740
     caggggcagg tgatcgtaca gcgacgattc ccggaaacgg agccctttgt acagacgggc      1800
     tgtcagttgt tggcggcccc ccagggactc tatacggtcg ggtcccaaac gattcagtta      1860
     ttgcagttat ag                                                          1872
//

If you have problems or comments...

PBIL Back to PBIL home page