(data stored in ACNUC27125 zone)

EMBL: CP000828.PE403

CP000828.PE403       Location/Qualifiers
FT   CDS_pept        413083..413196
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0438"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25494"
FT                   /db_xref="UniProtKB/TrEMBL:B0CB04"
FT                   /protein_id="ABW25494.1"
FT                   /translation="MSLESISWRLLQMGRIIIAASQIECQQKYNRPCDFNE"
     gtgagtctag agtctatttc atggcgattg ctacagatgg gccgaattat aattgctgct        60
     agtcagattg agtgtcaaca aaaatacaat cgcccctgcg atttcaatga ataa             114
//

If you have problems or comments...

PBIL Back to PBIL home page